SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000056774 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000056774
Domain Number 1 Region: 117-295
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.08e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.000000155
Further Details:      
 
Domain Number 2 Region: 615-721
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-31
Family SH2 domain 0.000000653
Further Details:      
 
Domain Number 3 Region: 302-437
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-30
Family SH2 domain 0.0000011
Further Details:      
 
Domain Number 4 Region: 4-83
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-17
Family SH3-domain 0.00000482
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000056774
Domain Number - Region: 540-586
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0863
Family Occludin/ELL domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000056774   Gene: ENSMUSG00000041417   Transcript: ENSMUST00000055518
Sequence length 724
Comment pep:known chromosome:NCBIM37:13:102450716:102538172:-1 gene:ENSMUSG00000041417 transcript:ENSMUST00000055518
Sequence
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEDIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKTEADTEQQALPLPDLAE
QFAPPDVAPPLLIKLLEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMIDVH
VLADAFKRYLADLPNPVIPVAVYNEMMSLAQELQSPEDCIQLLKKLIRLPNIPHQCWLTL
QYLLKHFFKLSQASSKNLLNARVLSEIFSPVLFRFPAASSDNTEHLIKAIEILISTEWNE
RQPAPALPPKPPKPTTVANNSMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNHDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
Download sequence
Identical sequences P26450
10090.ENSMUSP00000056774 NP_001070963.1.92730 ENSMUSP00000047004 ENSMUSP00000056774 ENSMUSP00000056774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]