SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000057103 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000057103
Domain Number 1 Region: 185-326
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-37
Family Third domain of FERM 0.00048
Further Details:      
 
Domain Number 2 Region: 85-187
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-26
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 3-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.36e-21
Family First domain of FERM 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000057103   Gene: ENSMUSG00000036131   Transcript: ENSMUST00000060650
Sequence length 703
Comment pep:novel chromosome:NCBIM37:X:48248357:48295887:-1 gene:ENSMUSG00000036131 transcript:ENSMUST00000060650
Sequence
MLHLKVQFLDDSQKIFVVDQKSSGKALFNLSCGHLNLAEKEYFGLEFCSHSGNNVWLELL
KPITKQVKNPKEVVFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLALGRLPCSDNCTAL
MVSHILQSELGDFHEETVRKHLVQTQYLPSQASLESKIMQFHQQHIGRSPAESDILLLDI
ARKLDMYGIRPQPASDGEGMQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLI
KLHANILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFR
YSGRTQRQLLEYGKKGRLKSLPFERKQYPSQYHERQCRSSPDILSDVSKQVEDLRLTYGS
SYYRNVNGVHASESMLDSRRRNSAVEVTFAAELEHSKPEAEATSLHPSQSSSSFTFIYAD
PVFNTDPEPIEFFEERSPLSSFQTTSKFADSHTSKASPARQLTYTDVPYIPCTSQKVDIM
PPQVFFYVDKPPQVPRRSLIMAEENMRPDSYVDHSAIKPAKRSPRNMRIKSLQQDLQELQ
EAMARTSGRSNINVEPEEEDPHLDDAFAYNLQEQTPKRSQSQSDMKTIRFPFGSEFRPLG
PCPALTRKTDLFACTFAEQEFPTVLIDQSSAERYVASESSDSESEIIKPDYYFLYGKGTK
SPRARIRLSSGSLQLEEEDETISFATPGAEDRTLLKPCNYFLA
Download sequence
Identical sequences A2AD83
10090.ENSMUSP00000057103 NP_001177261.1.92730 XP_006541568.1.92730 XP_006541569.1.92730 ENSMUSP00000057103 ENSMUSP00000057103 ENSMUSP00000057103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]