SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000057275 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000057275
Domain Number 1 Region: 319-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-29
Family SPRY domain 0.068
Further Details:      
 
Domain Number 2 Region: 153-283
Classification Level Classification E-value
Superfamily ARM repeat 0.0000015
Family Armadillo repeat 0.036
Further Details:      
 
Domain Number 3 Region: 517-568
Classification Level Classification E-value
Superfamily RING/U-box 0.00000163
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000057275   Gene: ENSMUSG00000050079   Transcript: ENSMUST00000060389
Sequence length 576
Comment pep:known chromosome:NCBIM37:8:97125855:97184175:1 gene:ENSMUSG00000050079 transcript:ENSMUST00000060389
Sequence
MIVFGWAVFLASRSLGQGLLLTLEEHIAHLLGTTGATATMGNSCICRDDSGAEDNVDTHQ
QQAENSTVPTADSRSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQE
PPYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTE
ILNLNGEVACQDSGHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGILEYLLQCLKLQSHP
TVMLFALIALEKFAQTSENKLTISESSISDRLVTLELWADDPDYLKRQVGFCAQWSLDNL
FLKEGRQLTYEKVDLNNIRAMLNSNDVSEYLKISPHGLEARCDASSFESVRCTFCVDTGV
WYYEVTVVTSGVMQIGWATRDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHVHP
CWKEGDTVGFLLDLNEKQMIFFLNGNQLPPEKQVFSSTVSGFFAAASFMSYQQCEFNFGA
RPFKYPPSMKFSTFNDYAFLTAEEKIILPRHRRLALLKQVSIRENCCSLCCDEVADTQLK
PCGHSDLCMDCALQLETCPLCRKEIVSRIRQISHIS
Download sequence
Identical sequences Q8BVR6
10090.ENSMUSP00000057275 ENSMUSP00000057275 ENSMUSP00000057275 NP_080550.3.92730 XP_006531376.1.92730 ENSMUSP00000057275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]