SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000057690 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000057690
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-35
Family Dual specificity phosphatase-like 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000057690   Gene: ENSMUSG00000047067   Transcript: ENSMUST00000060913
Sequence length 163
Comment pep:known chromosome:NCBIM37:1:94803566:94805197:1 gene:ENSMUSG00000047067 transcript:ENSMUST00000060913
Sequence
MGTSEAAPPPFARVAPALFIGNARAAGATELLVRAGITLCVNVSRQQPGPRAPGVAELRV
PVFDDPAEDLLTHLEPTCAAMEAAVRDGGSCLVYCKNGRSRSAAVCTAYLMRHRGHSLDR
AFQMVKSARPVAEPNLGFWAQLQKYEQTLQAQAILPREPIDPE
Download sequence
Identical sequences Q8BTR5
ENSMUSP00000057690 NP_780327.1.92730 ENSMUSP00000057690 10090.ENSMUSP00000057690 ENSMUSP00000057690 NYSGXRC-8736b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]