SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000057859 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000057859
Domain Number 1 Region: 580-904
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.05e-51
Family Diacylglycerol kinase-like 0.011
Further Details:      
 
Domain Number 2 Region: 389-471
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.78e-16
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 53-103
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000284
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0054
Further Details:      
 
Domain Number 4 Region: 171-232
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000349
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0016
Further Details:      
 
Domain Number 5 Region: 294-371
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000428
Family Ras-binding domain, RBD 0.022
Further Details:      
 
Domain Number 6 Region: 112-163
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000924
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000057859   Gene: ENSMUSG00000004815   Transcript: ENSMUST00000053913
Sequence length 934
Comment pep:known chromosome:NCBIM37:5:109075712:109089830:-1 gene:ENSMUSG00000004815 transcript:ENSMUST00000053913
Sequence
MAAAAEPGARTWPGSGSPRLGSPAGSPVLGISGRTRPGSGPERTSRAIGSAAPGHSFRKV
TLTKPTFCHLCSDFIWGLAGFLCDVCNFMSHEKCLKQVKTPCTSIAPSLVRVPVAHCFGS
LGLYKRKFCVVCRKSLEVPAFRCEVCELHVHPDCVPFACSDCRQCHQDGQQDYDTYHHHW
REGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSVCSTALAPECTFGRLRSMVLPP
SCVRLLSRNFSKMHCFRIPETMVLELGDGDDGVDGSAAIGTGREVLTATESTKQTLKIFD
GNDSMRKNQFRLVTVSRLARNEEVMEAALRAYYISEDPKDFQLQALPLSGNAQALGKAGT
TEEEASKGSCPRDSVPEAWVIRSLPRTQEILKIYPGWLKVGVAYVSIRVNSQSTARSVVQ
EVLPLFGQQVEDKERFQLIEVLMSSRQVQRTVLADEEPLLDRLWDIRQTSVRQVSQTRFY
VAETRATAPRVSLFVGGLPPGLSPQDYSNLLHEAMATKAAVVSVSHVYSLQGAVILDVTC
FAEAERLYMLARDTAVHGRPLTALVLPDVLHTKLPPDCCPLLVFVNPKSGGLKGRELLCS
FRKLLNPHQVFELTNGGPLPGFHLFSQVPSFRVLVCGGDGTVGWVLAALEETRRHLACPE
PSVAILPLGTGNDLGRVLRWGAGYSGEDPFSVLVSVDEADAVLMDRWTILLDAHEIDSTE
NNVVETEPPKIVQMNNYCGIGIDAELSLDFHQAREEEPGKFTSRFHNKGVYVRVGLQKIS
HSRSLHKEIRLQVEQQEVELPSIEGLIFINIPSWGSGADLWGSDNDSRFEKPRIDDGLLE
VVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISATAP
KVHMLRKAKQKPRKAGANRDTRVDTLPAPEGNPL
Download sequence
Identical sequences Q6P5E8
ENSMUSP00000057859 10090.ENSMUSP00000057859 ENSMUSP00000057859 ENSMUSP00000057859 NP_950176.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]