SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000058135 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000058135
Domain Number 1 Region: 614-915
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-83
Family Protein kinases, catalytic subunit 0.0000000000861
Further Details:      
 
Domain Number 2 Region: 20-195
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-77
Family Ephrin receptor ligand binding domain 0.00000000991
Further Details:      
 
Domain Number 3 Region: 324-530
Classification Level Classification E-value
Superfamily Fibronectin type III 4.23e-41
Family Fibronectin type III 0.0000282
Further Details:      
 
Domain Number 4 Region: 911-985
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.52e-21
Family SAM (sterile alpha motif) domain 0.0000281
Further Details:      
 
Domain Number 5 Region: 253-324,362-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000292
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000058135   Gene: ENSMUSG00000028664   Transcript: ENSMUST00000059287
Sequence length 987
Comment pep:novel chromosome:NCBIM37:4:136209523:136391871:-1 gene:ENSMUSG00000028664 transcript:ENSMUST00000059287
Sequence
MAVRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQ
VCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADF
DLATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRNGFYLAFQD
YGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLY
CNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGA
TNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNI
ICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPF
SPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKQELS
EYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIKE
KLPLIVGSSAAGLVFLIAVVVIAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDP
FTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGY
TEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFT
VIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPT
YTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAI
EQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSG
INLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVT
LAGHQKKILNSIQVMRAQMNQIQSVEV
Download sequence
Identical sequences ENSMUSP00000058135 ENSMUSP00000101471 NP_001277682.1.92730 ENSMUSP00000058135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]