SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000058572 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000058572
Domain Number 1 Region: 1983-2261
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.39e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000124
Further Details:      
 
Domain Number 2 Region: 667-854
Classification Level Classification E-value
Superfamily Fibronectin type III 2.44e-43
Family Fibronectin type III 0.00096
Further Details:      
 
Domain Number 3 Region: 396-447,530-653
Classification Level Classification E-value
Superfamily Fibronectin type III 2.93e-38
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 1340-1539
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-37
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 5 Region: 1149-1341
Classification Level Classification E-value
Superfamily Fibronectin type III 4.98e-37
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 6 Region: 56-194,254-306
Classification Level Classification E-value
Superfamily Fibronectin type III 1.59e-36
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 856-1053
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-35
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 8 Region: 1541-1736
Classification Level Classification E-value
Superfamily Fibronectin type III 1.35e-24
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 9 Region: 263-394
Classification Level Classification E-value
Superfamily Fibronectin type III 1.45e-20
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 10 Region: 1009-1144
Classification Level Classification E-value
Superfamily Fibronectin type III 6.16e-18
Family Fibronectin type III 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000058572   Gene: ENSMUSG00000035916   Transcript: ENSMUST00000050702
Sequence length 2300
Comment pep:known chromosome:NCBIM37:10:106954416:107157083:-1 gene:ENSMUSG00000035916 transcript:ENSMUST00000050702
Sequence
MDFLFFFLFSLIGTSESQVDVSGSFDDTVYDITLSSISATTYSSPVSRTLATNVSKPGPP
VFLAGERVGSAGILLSWNTPPNPNGRIISYVVKYKEVCPWMQTAYTRVRAKPDSLEVLLT
NLNPGTTYEIKVAAENSAGIGVFSDPFLFQTAESAPGKVVNLTVEALNYSAVNLIWYLPR
QPNGKITSFKISVKHARSGIVVKDVSIKVEDLLSGKLPECNENSDSFLWSTTSPSPTLSR
ATPPLRTTHLSNTLARNKISSVWKEPISFVVTHLRPYTTYLFEVSAVTTEAGYIDSTIVR
TPESVPEGPPQNCITGNVTGKAFSISWDPPAIVTGKFSYRVELYGPTGRILDNSTKDLRF
VFTHLTPFTMYDVYVAAETSAGVGPKSNLSVFTPPDVPGAVFDLQIVEVEATEIRVSWRK
PRQPNGIISQYRVKVSVLESGVILENTLLTGQDEYINNPMTPEIMNLVDPMIGFYEGSGE
MSSDLHSLASFIYNSHPHDFPARTRVEDQRSPVVATRNQYMTDIAAEHLSYVIRRLVPFT
EHTISVSAFTVMGEGPPTVLTVRTREQVPSSIQIINYKNISSSSILLYWDPPEYPNGKIT
HYTIYAMELDTNRAFQMTTVDNSFLITGLKKYTRYKMRVAASTHVGESSLSEENDLFVRT
PEDEPESSPQDVKVTDVSPSELSLTWSPPEKPNGIIIAYEVFYQNADALFVKNTSTTNIT
LSDLKPYTLYNISIQSYTRLGHGNQSSSLLSVRTSETVPDSAPENITYKNISSEEIEIFF
LPPRSPNGIIQKYTIYLKRSNSHEARTIETTSLTLTIGGLKKYTHYVIEVSASTLKGEGV
RSMPISILTEEDAPDSPPQNFSVKQLSGVTVMLSWQPPLEPNGIILYYTVYVWDKVSLKT
INATEVSLELSDLDYHADYSAYVTASTRFGDGKTRSSVINFRTPEGEPSDPPKDVHYVNL
SSSSIILFWTPPVKPNGIIQYYSVYYQNTSSTFVQNFTLLEVTQEPGNVTVSARIYKLAV
FSYYTFWLTASTLVGNGNKSSDVIHVYTDQDIPEGGVGNLTYESLSSTAINVSWTPPSQP
NGLVFYYVSLNLQQSPPRHRRPPLTTYENSIYFDNLEKYTDYIFKITPSTEKGFSETYTA
QLHIKTEEDVPDTPPIINTFKNLSSTSILLSWDPPLKPNGAILSYHLTLQGTHANRTFVT
SGNHIVLEELSPFTLYSFLAAARTMKGLGPSSILFFYTDESAPLAPPQNLTLINYTSDFV
WLTWSPSPLPGGIVKVYSFKIHEHETDTVFYKNISGFQTDAKLAGLEPVSTYSISVSAFT
KVGNGNQFSNVVKFTTQESVPDAVQNIACVARDWQSVSVMWDPPRKANGIIIHYMITVEG
NSTKVSPRDPMYTFTKLLANTSYIFEVRASTSAGEGNESQCNVSTLPETVPSVPTNTAFS
NVQSTSVTLRWIKPDTILGYFQNYKITTQLRAQKCREWEPEECVEHQEVQYLYEANQTED
TVRGLKKFQWYRFQVAASTNAGYGNASSWISTQTLPGPPDGPPENVRVVATSPFGINISW
NEPAIITGPTFYLIDVKSVDNDNFNISFVKSNEENKTTEINDLEVFTRYSVVITAFVGNV
SGAYTDGKSSAEVIITTLESVPKDPPNNMTFQKIPDEVTKFQLSFLPPSQPNGNIQVYQA
LVYREDDPTAVQIHNLSIIQKTDTSVIAMLEGLKGGHTYNISVYAINSAGAGPKVQMRIT
MDIKAPARPKTKPIPIHDATGKLLVTSTTITIRMPICYYNDDHGPIRNVQVLVAEAGAQQ
DGNVTKWYDAYFNKARPYFTNEGFPNPPCIEGKTKFSGNEEIYVIGADNACMIPGNEEKI
CNGPLKPKKQYLFKFRATNVMGQFTDSEYSDPIKTLGEGLSERTVEIILSVTLCILSIIL
LGTAIFAFARIRQKQKEGGTYSPRDAEIIDTKFKLDQLITVADLELKDERLTRLLSYRKS
IKPVSKKSFLQHVEELCTNNNLKFQEEFSELPKFLQDLSSTDADLPWNRAKNRFPNIKPY
NNNRVKLIADVSIPGSDYINASYVSGYLCPNEFIATQGPLPGTVGDFWRMVWETRAKTLV
MLTQCFEKGRIRCHQYWPEDNKPVTVFGDILITKLMEDIQIDWTIRDLKIERHGDCMTVR
QCNFTGWPEHGVPENTTPLIHFVKLVRTSRAHDATPMVVHCSAGVGRTGVFIALDHLTQH
IHDHDFVDIYGLVAELRSERMCMVQNLAQYIFLHQCILDLLSNKGGHQPVCFVNYSTLQK
MDSLDAMEGDVELEWEETTM
Download sequence
Identical sequences P0C5E4
ENSMUSP00000058572 ENSMUSP00000058572 ENSMUSP00000058572 10090.ENSMUSP00000058572 NP_001074901.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]