SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000058757 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000058757
Domain Number 1 Region: 220-526
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.05e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000341
Further Details:      
 
Domain Number 2 Region: 111-216
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-31
Family SH2 domain 0.000000695
Further Details:      
 
Domain Number 3 Region: 3-106
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-29
Family SH2 domain 0.000000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000058757   Gene: ENSMUSG00000043733   Transcript: ENSMUST00000054547
Sequence length 597
Comment pep:known chromosome:NCBIM37:5:121580543:121641406:-1 gene:ENSMUSG00000043733 transcript:ENSMUST00000054547
Sequence
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLVDQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQRSFR
Download sequence
Identical sequences P35235
ENSMUSP00000058757 ENSMUSP00000058757 ENSMUSP00000098333 NP_035332.1.92730 XP_006970839.1.50099 10090.ENSMUSP00000058757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]