SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000058813 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000058813
Domain Number 1 Region: 24-152
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-44
Family Regulator of G-protein signaling, RGS 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000058813   Gene: ENSMUSG00000051079   Transcript: ENSMUST00000052375
Sequence length 158
Comment pep:known chromosome:NCBIM37:1:145985797:146024502:-1 gene:ENSMUSG00000051079 transcript:ENSMUST00000052375
Sequence
MSRHICWICKLCRDESKRLPSNLTLDEVLKWAQSLESLMATKYGPIVYTAYLKLEHSDEN
IKFWMACETYKKIASRRGRISRAKKLYNIYIQPQSPREINIDSTTREAIIKSIREPTQTC
FEEAQKIVYMHMEMDSYPRFLKSEMYQQLLKTVQSQSS
Download sequence
Identical sequences Q8K443
ENSMUSP00000058813 ENSMUSP00000058813 10090.ENSMUSP00000107572 NP_694811.1.92730 XP_006529676.1.92730 ENSMUSP00000058813 ENSMUSP00000107572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]