SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000058858 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000058858
Domain Number 1 Region: 202-397
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.27e-54
Family Reprolysin-like 0.0004
Further Details:      
 
Domain Number 2 Region: 416-491
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 9.54e-22
Family Blood coagulation inhibitor (disintegrin) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000058858   Gene: ENSMUSG00000050190   Transcript: ENSMUST00000056023
Sequence length 736
Comment pep:known chromosome:NCBIM37:8:44710305:44712624:-1 gene:ENSMUSG00000050190 transcript:ENSMUST00000056023
Sequence
MTGAKVVVHKRNMFLKFCLWTMFFFSAYSPIGHAKYSSLPEVVTPLRVTVTRGNNSSPGW
LSYSLSIGGQRHIITMKPKENLISRNFLLFTYSDQGDLLEEHPFVQNDCYYHGYVDEDPE
SLVIVNTCFGSLQGTLEINGTIYEIMPRSKTSTFEHLAYKMDSGESEPSPMRCGLSEEEI
AQQMNLQESNASTLLQIPYENWWTHHRFIDYFVVIDHNCYVHRNNNTTTCIQDMLQVVNG
INGYFLQIQTDVVLTKVEVWSQNNLINVEEEMSAALDAFCSWKKNAIGNRVRHDIIHLFV
RHNYVKFLGMAKLGQVCLTLNCAVNSFLTDSLSYLAFIVAHEMGHNLGMKHDGSACTCGL
HTCIMYPYAYISPKFSNCSYEEMFSVVNRRSCLYNIPDALKTITLVPTMCGNNLVEEGEQ
CDCGNSESCLQDPCCSSDCVLKPGAKCAFGLCCKDCQFLQTGTVCRQEKNECDLPEWCNG
TSGECPGDVYKADGIRCSRGGYCYKMECQRHDRQCREIFGKRSRSADEICYMEMNRRGDR
FGNCGNDSSMYKRCELTDVLCGRIQCENVIKLPQRRNHETVHYTHFSNNTCWTMDYHFGI
TIDDVGAVSDGTPCAPDHICLDRKCVSKSVLVSNCTPHLCHMQGVCNNKHHCHCTNTWEP
PDCQLHGHGGSIDSGPPPVPLSPSNWSMYFLAFIIMYVLGFIALYGIRELRKKLLKESVP
ESDSGDKNLTRKQQDL
Download sequence
Identical sequences Q7M766
ENSMUSP00000058858 NP_001020411.1.92730 XP_006509518.1.92730 ENSMUSP00000058858 ENSMUSP00000058858 10090.ENSMUSP00000058858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]