SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000059894 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000059894
Domain Number 1 Region: 119-502
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.36e-135
Family Myotubularin-like phosphatases 0.0000000584
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-19
Family GRAM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000059894   Gene: ENSMUSG00000035078   Transcript: ENSMUST00000058679
Sequence length 545
Comment pep:known chromosome:NCBIM37:14:64142453:64162790:-1 gene:ENSMUSG00000035078 transcript:ENSMUST00000058679
Sequence
MEFAELIKTPRVDNVVLHRPFYTAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGSLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSVTLMYPFFYRPMFEVI
EDGWHSFLPEQEFEFYSSATSEWRLSYINKDFSICPSYPPTVIVPKSVDDEALRKVAAFR
HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYLIDTRSLN
VAQQARAKGGGFEQEAHYPQWRRIHKSIERYHVLQESLIKLVEACNEQTHNMDRWLGKLE
ASNWLTHIKEILTTACLAAQCIDREGASVLIHGTEGTDSTLQVTSLAQIILEPRSRTIRG
FEALIEREWLQAGHPFQQRCAQSAYCSSKQKWEAPVFLLFLDCVWQILRQFPCSFEFNEH
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNRPGELSKFTNPLFEANNL
VIWPSVAPQSLQLWEGIFLRWSRSSKYLDEAYEEMVNIIEYNKELQAKVNVLRRQLAELE
TEDGL
Download sequence
Identical sequences Q9Z2D0
ENSMUSP00000059894 ENSMUSP00000059894 10090.ENSMUSP00000059894 ENSMUSP00000059894 NP_808262.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]