SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000060103 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000060103
Domain Number 1 Region: 442-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-26
Family SPRY domain 0.00095
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily RING/U-box 7.66e-21
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Domain Number 3 Region: 312-384
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-19
Family SPRY domain 0.0032
Further Details:      
 
Domain Number 4 Region: 95-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000244
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000060103
Domain Number - Region: 387-434
Classification Level Classification E-value
Superfamily ARM repeat 0.00334
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000060103   Gene: ENSMUSG00000024457   Transcript: ENSMUST00000053434
Sequence length 545
Comment pep:known chromosome:NCBIM37:17:36974131:36996325:1 gene:ENSMUSG00000024457 transcript:ENSMUST00000053434
Sequence
MAVSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTSDIRPISGNRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDNGRQPGELAREPQDMKLCERHQEKLHYYCEDDGKLL
CVMCRESREHRPHTAVLVEKAALPHREKILNHLNTLRRDRDKIQGFQAKGEADILAALTK
LQEQRQYIVAEFKQGHQFLKKREQHLLDQLATLEQLLTEGREKFKTRGVSELDRLTLVIS
ELEGKARQPAAELMQDVCTTQDTKDFANKYPRKKFWIGKAIPHMVKRKAGEFSDKLLSLQ
RGLRQFQGKLLRDLEYKTVSVTLDPQSASGYLHLSEDWKCVTYTGQYQSDCLLPQQFDCE
PGVLGSKGFTWGKVYWEVELEREGWSEDEEEGEEEEEGEEEEEDEEVGYGDGYEDWETDE
EDESLGEEEEEEEEEEEEVQESCMVGVAKDSVKRKGDLSLRPEDGVWALRLSPSGIWANT
SPEAQLFPVLRPRRVGIALDYEGGTVTFTNAESQELIYTFTTTFTRRLVPFLWLKWPGAR
LLLRP
Download sequence
Identical sequences Q99PN3
ENSMUSP00000060103 ENSMUSP00000060103 NP_001020770.2.92730 NP_001273655.1.92730 NP_001273656.1.92730 XP_006524276.1.92730 10090.ENSMUSP00000060103 ENSMUSP00000060103 ENSMUSP00000114896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]