SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000060433 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000060433
Domain Number 1 Region: 376-498
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-28
Family SH2 domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000060433   Gene: ENSMUSG00000044813   Transcript: ENSMUST00000061986
Sequence length 503
Comment pep:known chromosome:NCBIM37:4:45436150:45543202:-1 gene:ENSMUSG00000044813 transcript:ENSMUST00000061986
Sequence
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERREQPPQAVPQACSASSASCGSAAA
CFSASSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGGGGG
DPGGGQRAFTAAAGAAGCCCAAAGAGAAASSSSSSGSPHLYRSSSERRPTTPAEVRYISP
KHRLIKVESASAAGDPPGGVCSGGRTWSPTTCGGKKLLNKCSAEETGAGQKDKVTIADDY
SDPFDAKSDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQ
SVDSDSESTVSLRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSP
SRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPTIPLEKQIWYHGAISRSDAENLLRL
CKECSYLVRNSQTSKHDYSLSLKSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYT
TRKLPIKGAEHLSLLYPVAVRTL
Download sequence
Identical sequences Q6PD21
ENSMUSP00000060433 NP_001028478.1.92730 ENSMUSP00000060433 10090.ENSMUSP00000060433 ENSMUSP00000060433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]