SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000060907 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000060907
Domain Number 1 Region: 43-360
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-67
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000060907   Gene: ENSMUSG00000042978   Transcript: ENSMUST00000056028
Sequence length 417
Comment pep:known chromosome:NCBIM37:7:133416133:133438513:1 gene:ENSMUSG00000042978 transcript:ENSMUST00000056028
Sequence
MSVGCPEPEPLHSLPCCGPGAAPVPGAGVPLLTEDMQALTLRTLAASDVTKHYELVRELG
KGTYGKVDLVAYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVVFET
EECYVFAQEYAPAGDLFDIIPPQVGLPEDTVKRCVQQLGLALDFMHSRQLVHRDIKPENV
LLFDRECRRVKLADFGMTRRVGCRVKRVSGTIPYTAPEVCQAGRADGFAVDTGVDVWAFG
VLIFCVLTGNFPWEAASGADAFFEEFVRWQRGRLPGLPSQWRRFTEPALRMFQRLLALEP
ERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRLPGSLRLEAPGPLKRTVLTESGSG
SRPSPPSVGPVVPVPVPVPVPVPEAGLAPPAPPGRTDGRTDKSKGQVVLATAIEICV
Download sequence
Identical sequences Q8QZX0
ENSMUSP00000060907 10090.ENSMUSP00000060907 NP_663562.1.92730 XP_017177409.1.92730 ENSMUSP00000060907 ENSMUSP00000060907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]