SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000062231 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000062231
Domain Number 1 Region: 322-391
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.71e-16
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000062231   Gene: ENSMUSG00000047181   Transcript: ENSMUST00000055947
Sequence length 417
Comment pep:known chromosome:NCBIM37:11:94871193:94887401:1 gene:ENSMUSG00000047181 transcript:ENSMUST00000055947
Sequence
MASSKLREPVDEVFDLDLAVPETTRLDSSLHKARAQLLAKGRRHRPSRSRLRDSASSAED
GEGSDGPGGKVTDGCGSPLHRLRSPLHSGPGSPASGSFCLEPPGLRRSLDEDEPPPSPLA
RYRPLHNAASHEGLAATSGSPPRSAPSSDSSPSFVRRYPRAEPHSEDDSRDASPPEPASP
TIGLDKKTRRKFLDLGVTLRRASTSRSRKEKGSNRLSMGSRESVEGSGRTGSSPFLPFSW
FTDSGKGSASSGSTTSPTCSPKHEGFSPKKSASQESTLSDDSTPPSSSPKIPGGPRQETK
CSYPYHTLSQSSDEFLDESLPAVQHWTSQQVGQWLHSLNLEQYAAEFAARQVDGPQLLQL
DGSKLKSLGLSNSHDRALVKRKLKELAAAAEKERKAQEKTAKQREKLRRRENDAKKS
Download sequence
Identical sequences Q8K070
NP_666137.1.92730 10090.ENSMUSP00000062231 ENSMUSP00000062231 ENSMUSP00000062231 ENSMUSP00000062231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]