SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000062333 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000062333
Domain Number 1 Region: 269-562
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.19e-62
Family Protein kinases, catalytic subunit 0.000000819
Further Details:      
 
Domain Number 2 Region: 65-182
Classification Level Classification E-value
Superfamily Snake toxin-like 4.4e-51
Family Extracellular domain of cell surface receptors 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000062333   Gene: ENSMUSG00000032440   Transcript: ENSMUST00000061101
Sequence length 592
Comment pep:known chromosome:NCBIM37:9:115993415:116084383:-1 gene:ENSMUSG00000032440 transcript:ENSMUST00000061101
Sequence
MGRGLLRGLWPLHIVLWTRIASTIPPHVPKSDVEMEAQKDASIHLSCNRTIHPLKHFNSD
VMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNI
TLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTT
SSPDLLLVIIQVTGVSLLPPLGIAIAVIIIFYCYRVHRQQKLSPSWESSKPRKLMDFSDN
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYSSWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDSVLRDRGRPEIPSFWLNHQGIQIVCE
TLTECWDHDPEARLTAQCVAERFSELEHPERLSGRSCSQEKIPEDGSLNTTK
Download sequence
Identical sequences Q543C0 Q62312
ENSMUSP00000035014 ENSMUSP00000062333 ENSMUSP00000062333 10090.ENSMUSP00000062333 NP_033397.3.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]