SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000062996 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000062996
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.5e-63
Family GDI-like N domain 0.000000000319
Further Details:      
 
Domain Number 2 Region: 389-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000012
Family GDI-like N domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000062996   Gene: ENSMUSG00000021218   Transcript: ENSMUST00000059515
Sequence length 445
Comment pep:known chromosome:NCBIM37:13:3537321:3565507:1 gene:ENSMUSG00000021218 transcript:ENSMUST00000059515
Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPG
QPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVP
STEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGVDPKKTSMRDVYKKFDLGQD
VIDFTGHSLALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPIEEIIVQNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRV
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETK
EPEKEIRPALELLEPIEQKFVSISDLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDI
YKRMTGSEFDFEEMKRKKNDIYGED
Download sequence
Identical sequences P50399 Q61598
ENSRNOP00000024952 NP_032138.3.92730 NP_058972.2.100692 NP_058972.2.4139 10090.ENSMUSP00000062996 10116.ENSRNOP00000024952 ENSMUSP00000062996 ENSRNOP00000027516 ENSMUSP00000062996 ENSMUSP00000062996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]