SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000063519 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000063519
Domain Number 1 Region: 797-936
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.68e-32
Family Synaptotagmin-like (S variant) 0.052
Further Details:      
 
Domain Number 2 Region: 1621-1750
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.42e-19
Family Synaptotagmin-like (S variant) 0.0088
Further Details:      
 
Domain Number 3 Region: 248-342
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000234
Family PLC-like (P variant) 0.00000262
Further Details:      
 
Domain Number 4 Region: 662-722
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000112
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000063519
Domain Number - Region: 137-175
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00695
Family PLC-like (P variant) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000063519   Gene: ENSMUSG00000034799   Transcript: ENSMUST00000066644
Sequence length 1797
Comment pep:known chromosome:NCBIM37:8:74150614:74195546:-1 gene:ENSMUSG00000034799 transcript:ENSMUST00000066644
Sequence
MSLLCVGGRFCVDAGKYALNSAAGSAEARGSLFASPLGLEEGKEIILCKTQFPAALQLTL
SSNRDLPPATVCAASCLLHVTVGWRVTALALSIPETSPLTTLLRAPPPLWLPPPPKALSS
TDCPYSVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMLSHKVPPTKDC
FSQKPYGHPLQDAFPDPLPSCGDSTLGAYNSLSYKLFPYAMCLQASALTSLSLPSLLLIP
LCCAHSEINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQAIM
ADSEICGTKDPTFHRILLDAHFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDQQDK
PLPVPSSQCYDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRE
SYSDSMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEHSLQGSELDDERD
RDSYHSCHSSEDTTVAEPKEFKRISFPTAAPQKDDKVSAVPTEAPEVAKGIPKAATPEEK
AAAERAQEAEPPKSEESFRSREEEEGQEGQDAMSRAKANWLRAFNKVRMQLQELNSQPMG
SPGGGLIIIDSMPDIRKRKPIPLVSDLSLVQSRKAGITSALASSTLNNEELKNHVYKKTL
QALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNA
DCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVTKSAHTQQMK
AVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNP
VWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEMDV
WYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTDVQNNGVVKI
PDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLL
ANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPE
RLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYGR
EYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGK
ISAEVMWSLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVAELPTFKDRVPEY
PAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFE
IIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKEKEKVPCILMNNTQQ
LRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATSFQPHIEECVRQMGD
ILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWKL
VMNTMEKTIVLPPLTDQTGTQMIFNAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELAL
DTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDLLIKTFVQTQSAQGSGVEDP
VGEVSVHVELFTHPGTGEQKVTVKVVAANDLKWQTSGIFRPFIEVNIVGPQLSDKKRKFA
TKSKNNSWAPKYNESFQFSLSADAGPECYELQVCVKDYCFAREDRTVGLAVLQLRELAQR
GSAACWLPLGRRIHMDDTGLTVLRILSQRSNDEVAKEFVKLKSDTRSAEEGGAAPAP
Download sequence
Identical sequences ENSMUSP00000063519 10090.ENSMUSP00000063519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]