SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000063734 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000063734
Domain Number 1 Region: 199-343
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-38
Family Second domain of FERM 0.000000735
Further Details:      
 
Domain Number 3 Region: 499-586
Classification Level Classification E-value
Superfamily Moesin tail domain 8.37e-32
Family Moesin tail domain 0.0000262
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.61e-26
Family First domain of FERM 0.00000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000063734   Gene: ENSMUSG00000052397   Transcript: ENSMUST00000064234
Sequence length 586
Comment pep:known chromosome:NCBIM37:17:6942390:6987133:-1 gene:ENSMUSG00000052397 transcript:ENSMUST00000064234
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKENPVQFKFRAKFYPEDVAEELIQDITQKLFFLQVKDGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEMHKSGYLSSERLIPQRVMDQHKLSRDQWEDRIQVWHAEHR
GMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMLREKEELMLRLQDYEQKTKR
AEKELSEQIEKALQLEEERRRAQEEAERLEADRMAALRAKEELERQAQDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VNYHVQEGLQDEGAEPMGYSAELSSEGILDDRNEEKRITEAEKNERVQRQLLTLSNELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences P26040 Q4KML7
10090.ENSMUSP00000063734 ENSMUSP00000063734 ENSMUSP00000063734 NP_033536.2.92730 ENSMUSP00000063734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]