SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000065228 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000065228
Domain Number 1 Region: 56-226
Classification Level Classification E-value
Superfamily vWA-like 6.99e-18
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 2 Region: 324-386
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.67e-17
Family TFIIH p44 subunit cysteine-rich domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000065228   Gene: ENSMUSG00000021639   Transcript: ENSMUST00000066984
Sequence length 396
Comment pep:known chromosome:NCBIM37:13:101238535:101262516:-1 gene:ENSMUSG00000021639 transcript:ENSMUST00000066984
Sequence
MDEEPERTKRWEGGYERTWEILKEDETGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDETHYKELLAHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDNNSTEPGLTLGGYFCPQCRAKYC
ELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEISLEEYKGERFCYGCQGELKDQHVYV
CTVCQNVFCVDCDVFVHDSLHCCPGCIHKIPTPSGI
Download sequence
Identical sequences Q9JIB4
ENSMUSP00000065228 NP_071294.3.92730 ENSMUSP00000064590 IGBMC-0049-000 ENSMUSP00000065228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]