SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000065825 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000065825
Domain Number 1 Region: 91-223
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.19e-45
Family Regulator of G-protein signaling, RGS 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000065825   Gene: ENSMUSG00000019775   Transcript: ENSMUST00000064225
Sequence length 230
Comment pep:known chromosome:NCBIM37:10:4424141:4520878:1 gene:ENSMUSG00000019775 transcript:ENSMUST00000064225
Sequence
MGFFSKKLLLRWQLGSEAADMRKRQQSQNEGTQAVSQAPGNQRPNNTCCFCWCCCCSCSC
LTVRNEERGDSSGRSPHTTKMESIQVLEECQNPTADEVLSWSQNFDKMMKTPAGRNLFRE
FLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISILSPKEVSLDSRVREVIN
RSLLDPSPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKAFVESTTSCTSES
Download sequence
Identical sequences G5E8E0
NP_001155294.1.92730 ENSMUSP00000113519 ENSMUSP00000065825 ENSMUSP00000065825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]