SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000066031 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000066031
Domain Number 1 Region: 272-380
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-25
Family SH2 domain 0.000000595
Further Details:      
 
Domain Number 2 Region: 384-424
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000366
Family SOCS box-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000066031   Gene: ENSMUSG00000048379   Transcript: ENSMUST00000065562
Sequence length 436
Comment pep:known chromosome:NCBIM37:14:47896606:47915773:1 gene:ENSMUSG00000048379 transcript:ENSMUST00000065562
Sequence
MAENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSESEAIGTVENVEIPLR
SQERQLSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSGRHSPGLPSKRKIH
ISELMLDKCPFPPRSDLAFRWHFIKRHTVPMSPNSDEWVSADLSERKLRDAQLKRRNTED
DIPCFSHTNGQPCVITANSASCTGGHITGSMMNLVTNNSIEDSDMDSEDEIITLCTSSRK
RNKPRWEMEEEILQLEAPPKFHTQIDYVHCLVPDLLQISNNPCYWGVMDKYAAEALLEGK
PEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEH
YKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSPMKLYLKEYH
YKSKVRLLRIDVPEQQ
Download sequence
Identical sequences Q91ZA6
10090.ENSMUSP00000066031 ENSMUSP00000066031 ENSMUSP00000066031 ENSMUSP00000066031 NP_543119.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]