SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000066050 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000066050
Domain Number 1 Region: 148-309
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.35e-27
Family Dual specificity phosphatase-like 0.027
Further Details:      
 
Domain Number 2 Region: 12-121
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000000000368
Family Starch-binding domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000066050   Gene: ENSMUSG00000055493   Transcript: ENSMUST00000069106
Sequence length 330
Comment pep:known chromosome:NCBIM37:10:11063202:11179442:1 gene:ENSMUSG00000055493 transcript:ENSMUST00000069106
Sequence
MLFRFGVVVPPAVAGARQELLLAGSRPELGRWEPHGAVRLRPAGTAAGAAALALQEPGLW
LAEVELEAYEEAGGAEPGRVDTFWYKFLQREPGGELHWEGNGPHHDRCCTYNEDNLVDGV
YCLPVGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQLEHVTIKLK
HELGVTAVMNFQTEWDIIQNSSGCNRYPEPMTPDTMMKLYKEEGLSYIWMPTPDMSTEGR
VQMLPQAVCLLHALLENGHTVYVHCNAGVGRSTAAVCGWLHYVIGWNLRKVQYFIMAKRP
AVYIDEDALAQAQQDFSQKFGKVHSSICAL
Download sequence
Identical sequences Q9WUA5
10090.ENSMUSP00000066050 ENSMUSP00000066050 ENSMUSP00000066050 ENSMUSP00000066050 NP_034276.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]