SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000066554 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000066554
Domain Number 1 Region: 615-913
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-84
Family Protein kinases, catalytic subunit 0.00000000103
Further Details:      
 
Domain Number 2 Region: 29-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-73
Family Ephrin receptor ligand binding domain 0.000000941
Further Details:      
 
Domain Number 3 Region: 325-530
Classification Level Classification E-value
Superfamily Fibronectin type III 7.87e-41
Family Fibronectin type III 0.0000742
Further Details:      
 
Domain Number 4 Region: 909-979
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000494
Family SAM (sterile alpha motif) domain 0.0019
Further Details:      
 
Domain Number 5 Region: 254-316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000292
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000066554   Gene: ENSMUSG00000052504   Transcript: ENSMUST00000064405
Sequence length 984
Comment pep:known chromosome:NCBIM37:16:63543364:63863984:-1 gene:ENSMUSG00000052504 transcript:ENSMUST00000064405
Sequence
MDCHLSILVLLGCCVLSCSGELSPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCTCNAGYEERGFICQACRPGFYKASDGAAKCAKCPPHSSTQEDG
SMNCRCENNYFRAEKDPPSMACTRPPSAPRNVISNINETSVILDWSWPLDTGGRKDITFN
IICKKCGWNVRQCEPCSPNVRFLPRQLGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSS
PPRQYAAVSITTNQAAPSPVMTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTTYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGENS
HVVMIAISAAVAIIVLTVVTYVLVGRFCGYHKSKHSAEEKRLHFGNGHLKLPGLRTYVDP
HTYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGY
TEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFT
VIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAY
TTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDE
GYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPS
NLLLDQSNVDIATFHTTGDWLNGMRTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVV
GPQKKIISTIKALETQSKNGPVPV
Download sequence
Identical sequences Q8BRB1
ENSMUSP00000066554 10090.ENSMUSP00000066554 ENSMUSP00000066554 NP_034270.1.92730 ENSMUSP00000066554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]