SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000066696 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000066696
Domain Number - Region: 11-52
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00471
Family SAM (sterile alpha motif) domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000066696   Gene: ENSMUSG00000002881   Transcript: ENSMUST00000069792
Sequence length 486
Comment pep:known chromosome:NCBIM37:1:52514138:52557523:-1 gene:ENSMUSG00000002881 transcript:ENSMUST00000069792
Sequence
MATALPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAGEEEFLEIMALVGMAS
KPLHVRRLQKALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGISCNSYERSSSS
REPHLKIPKCAATTCVQSLGQGKSEVGSLALQSVSDSRLWQGHHATESEHSLSPADLGSP
ASPKESSEALDAAAALSVAECVERMAPTLPKSDLSEVKELLKNNKKLAKMIGHIFEMSDE
DPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQLCVKDNALLTRRDELFALA
RQVSREVTYKYTYRTTRLKCGERDELSPKRIKIEDGFPDFQESVPTLFQQARAKSEELAG
LGSQQAEKGMAKQMELLCAQAGYERLQQERRLTAGLYRQSSGEQSPDGGLPSDSSDGQGE
RPLNLRIPSVQNRQPHHFVVDGELSRLYSSEAKSHSSESLGILKDYPHSAFTLEKKVIKT
EPEDSR
Download sequence
Identical sequences Q61122
10090.ENSMUSP00000066696 ENSMUSP00000066696 NP_032693.2.92730 XP_006495833.1.92730 ENSMUSP00000066696 mmi002019601.1 ENSMUSP00000066696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]