SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000066743 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000066743
Domain Number 1 Region: 317-574
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.49e-107
Family STAT DNA-binding domain 0.000000000512
Further Details:      
 
Domain Number 2 Region: 134-317
Classification Level Classification E-value
Superfamily STAT 7.46e-62
Family STAT 0.0000000323
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 2.35e-44
Family Transcription factor STAT-4 N-domain 0.000021
Further Details:      
 
Domain Number 4 Region: 575-716
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-44
Family SH2 domain 0.000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000066743   Gene: ENSMUSG00000026104   Transcript: ENSMUST00000070968
Sequence length 755
Comment pep:known chromosome:NCBIM37:1:52176282:52218704:1 gene:ENSMUSG00000026104 transcript:ENSMUST00000070968
Sequence
MSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAAYDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMIIYNCLKEERKILENAQ
RFNQAQEGNIQNTVMLDKQKELDSKVRNVKDQVMCIEQEIKTLEELQDEYDFKCKTSQNR
EGEANGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLNSIELTQNTLINDELVEWK
RRQQSACIGGPPNACLDQLQSWFTIVAETLQQIRQQLKKLEELEQKFTYEPDPITKNKQV
LSDRTFLLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVSFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLEVFVPFQTTSLPVVVISNVSQLPSGWASILWY
NMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQFSSVTKRGLNADQLSMLGEKLLGPNAGPD
GLIPWTRFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDGCIMGFISKERERALLKDQ
QPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVM
AAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEVHP
SRLQTTDNLLPMSPEEFDEMSRIVGPEFDSMMSTV
Download sequence
Identical sequences A0A087WSP5
NP_001192242.1.92730 10090.ENSMUSP00000066743 ENSMUSP00000141132 ENSMUSP00000066743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]