SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000067614 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000067614
Domain Number 1 Region: 621-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.13e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000695
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-39
Family Third domain of FERM 0.00014
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 9.55e-36
Family Second domain of FERM 0.0000935
Further Details:      
 
Domain Number 4 Region: 29-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-23
Family First domain of FERM 0.00094
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 1.6e-20
Family PDZ domain 0.00000989
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000067614   Gene: ENSMUSG00000026384   Transcript: ENSMUST00000064091
Sequence length 926
Comment pep:known chromosome:NCBIM37:1:121556322:121734190:-1 gene:ENSMUSG00000026384 transcript:ENSMUST00000064091
Sequence
MTARFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFRVNKHDQGQVLLDIVFK
HLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYNLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLSCPCNTAALLASFAVQSELGDYNQSENLAGYLSDYSFIPNQ
PQDFEKEIAKLHQQHVGLSPAEAEFNYLNAARTLELYGVEFHYARDQSNNEILIGVMSGG
ILIYKNRVRMNTFLWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKTLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSLSDDRLETQSLPSRSPPGTPNHRNSSFTQEATRVRPSSVGHLV
DHVVHMSPSEDFVSQRSPSSTQANSIVLESSPSQETPEDGQPPALPPKQSKKNSWNQIHF
SNSQQDLVTHTNESFDVPSSPEKSTPNGGIPHDNLVLIKMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCEKHSGELVLL
VRPNAVYDVVEEKLESEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLAQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVLLKGNEDYINANYINMEIPSSSII
NQYIACQGPLPHTCKDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPSESSSYGCYQ
VTCHSEEGNPAYIFRKMTLFNQEKNESRQLTQIQYTAWPDHGVPDDSSDFLDFVCHVRDQ
RAGKEEPIIVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVKPLTTSSNK
Download sequence
Identical sequences Q9WU22
ENSMUSP00000067614 10090.ENSMUSP00000067614 ENSMUSP00000067614 ENSMUSP00000067614 NP_064317.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]