SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000069165 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000069165
Domain Number 1 Region: 668-764,811-875
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.00000000000209
Family Mannose 6-phosphate receptor domain 0.0081
Further Details:      
 
Domain Number 2 Region: 289-430
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000068
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 3 Region: 600-674
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000208
Family Growth factor receptor domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000069165   Gene: ENSMUSG00000056004   Transcript: ENSMUST00000069538
Sequence length 1028
Comment pep:known chromosome:NCBIM37:5:9266132:9480717:1 gene:ENSMUSG00000056004 transcript:ENSMUST00000069538
Sequence
MLLLTLRRAKGRDRGRPAGGPRRALSLPWSPAWICCWALAGCQAVWAGDSSSSGRPLPAC
QEKDYHFEYTECDSTGSRWRVAIPNSAVDCSGLPDPVKGKECTFSCASGEYLEMKNQVCS
KCVEGTYSLGSGIKFDEWDELPAGFSNVATFMDTVVGPSDSRPDGCNNSSWLPRGNYIES
NRDDCTVSLIYAVHLKKSGYVFFEYQYVDNNIFFEFFIQNDQCQEMDATTDKWVKLTDNG
EWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVKNITIEGVAYTSECFPCKPGTFSNK
PGSFNCQMCPRNTYSEKGAKECIRCKEDSQFSEEGASECVDRPPCTTKDYFQIHTPCDEE
GKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDCPPCNPGFYNNGSSSCHPCPPGTFSDG
TKECKSCPAGTEPALGFEYKWWNVLPANMKTSCFNVGNSKCDGMNGWEVAGDHIRSGAGG
SDNDYLILNLHIPGFKPPTSMTGATGSELGRITFVFETLCSADCVLYFMVDINRKSTNVV
ESWGGTKEKQAYTHVIFKNATFTFTWAFQRTNQGQDNRRFINDVVKIYSITATNAVDGVA
ASCRACALGSEQSASSCVPCPPGHYIEKETNQCKECPADTYLSIHQVYGKEACIPCGPGS
KSTQDHSLCYSDCFFYHEKENQTLHYDFRNLSSVGSLMNGPSFTSKGTKYFHFFNISLCG
HEGRKMALCTNNISDFTVKEMVTGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSIIL
ADMFLGVTVDTALQNVNIKEDMFPVSPSQVPDVHFFYKSSTATTSCINGRSTAVKMRCNP
MRPGAGVISVPSKCPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGACKRGLQEILYVW
NEPKWCIKGISLPEKKLSTCETVDFWLKVGAGVGAFTAVLLVALTCYFWKKNQKLEYKYS
KLVMTTNSKECELPAADSCAIMEGEDNEEDVVYSNKQSLLGKLKSLATKEKDDHFESVQL
KSSRCPNI
Download sequence
Identical sequences B9EHI9 Q3UZV7
ENSMUSP00000069165 10090.ENSMUSP00000069165 ENSMUSP00000069165 NP_766294.2.92730 ENSMUSP00000116026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]