SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000070019 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000070019
Domain Number 1 Region: 338-645
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-87
Family Protein kinases, catalytic subunit 0.0000000199
Further Details:      
 
Domain Number 2 Region: 157-282
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.4e-35
Family Synaptotagmin-like (S variant) 0.00000151
Further Details:      
 
Domain Number 3 Region: 25-87
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.39e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 4 Region: 98-154
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.05e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000070019   Gene: ENSMUSG00000052889   Transcript: ENSMUST00000064989
Sequence length 673
Comment pep:known chromosome:NCBIM37:7:129432811:129772169:1 gene:ENSMUSG00000052889 transcript:ENSMUST00000064989
Sequence
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
Download sequence
Identical sequences ENSMUSP00000070019 ENSMUSP00000138788 ENSMUSP00000064812 ENSMUSP00000070019 NP_032881.1.92730 XP_021051624.1.100879 10090.ENSMUSP00000070019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]