SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000071777 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000071777
Domain Number 1 Region: 1186-1937
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-263
Family Motor proteins 0.000000000208
Further Details:      
 
Domain Number 2 Region: 2848-2932
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000218
Family SH3-domain 0.0031
Further Details:      
 
Domain Number 3 Region: 3279-3395
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000419
Family Second domain of FERM 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000071777
Domain Number - Region: 3396-3444
Classification Level Classification E-value
Superfamily PH domain-like 0.0509
Family Phosphotyrosine-binding domain (PTB) 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000071777   Gene: ENSMUSG00000042678   Transcript: ENSMUST00000071880
Sequence length 3511
Comment pep:known chromosome:NCBIM37:11:60282841:60341871:1 gene:ENSMUSG00000042678 transcript:ENSMUST00000071880
Sequence
MADEEKKAKKGKKGKKAPEPEKPKRSLKGTSRLFMGFRDRTPKISKKGQFRSASAFFWGL
HTGPQKTKRKKKARTVLKSTSKLMTQMRVGKKKRAMKGKKPSFMVIRFPGRRGYGRLRPR
AQSLSKASTAINWLTKKFLLKKAEESGSEQATVDAWLQRSSSRVGSRKLPFPSGAEILRH
GGRLRRFPRSHSIYSSGEPVGFLPFEDEAPFRHAGSRKSLYGLEGFQDLGEYYDYHREGD
DYYDQQSLYHYEEQEPYLAEFGGYSPAWPPYDDYGYPPGDPYNYYHPDYYGDTLYPGYAY
GYGYGYDDFEPPYAPPSGYSSPYSYHDSFESEAYPYSYYLDPYATHHMPYPPYDFPYDTP
YDIPYFDPYGVPYAEGVYGGGAEAIYPPGMPYVYPEEPAFMYPWVPPPIMSPHNPYAHPM
DDIAELEEPEETGEERQSTSFRLPSAAFFEQQGMDKPARSKLSLIRKFRLFPRPQVKLFG
KEKLEVPLPPSLDIPLPLGDAEGEEEEEEMPPVPTMPYTHPYWSFLTPRQRNLQRALSAF
GARQGLGFGPEFGHPTPRPATSLARFLKKTLSEKKPIPRLRGSQKARGGRPPVREAAYKR
FGYKLAGMDPDRPNTPIVLRRSQPQARNNNNSHGPPSPRPAPRALTHWSALISPPMPAPS
PSPASPLTPPFSPTFSRPPRLASPYGSLRQHPPPWAAPAHVPFPPQANWWGFAEPPGTSP
EVAPDLLAFPVPRPSFRASRSRSRRAAYGFPSPSLIGSRRRPHLPSPQPSLRSLPGQGYH
SPLGPLSPQLSLRRGPFQPPFPPPPRRPQSLREAFSLRRASGRLGPPRSPVLGSPRPPSP
PPLLKHGPRHRSLNLPSRLPRTWRRLSEPPTRAVKPWVHRAYPPPPSAGPWGASTGALEQ
QENQREAEDSETPWTVPPLAPSWDVDMPPTQRPPSPWPEGIGSLRGFSRPPPVPENPLLE
HTSPSCEPQSEDRVSNLTGIFLGQHHDPGPGQLTKSADPSLEKPEEVVTLGDPQPPAEPE
ALNPTPPNKNVVSERKVLRLSASYPLVTCKQARATWPQWHRWKTVSRTPAPLAPTRAPGP
LLKAGEQPRAEPGRFAVVMPQVRGVSSFRPKGPAPVQPPEHPDQDPEQGPAPQACSLRWP
RLWPPTDAHCLWSRIRTYSSQSHLRGHGGDCHKSLWKKTRPQSWQNKMHSIRNLPSMRSR
EQHREDGVEDMTQLEDLQETTVLANLKTRFERNLIYTYIGSILVSVNPYRMFAIYGPEQV
QQYSGRALGENPPHLFAIANLAFAKMLDAKQNQCVIISGESGSGKTEATKLILRCLAAMN
QRRDVMQQIKILEATPLLEAFGNAKTVRNDNSSRFGKFVEIFLEGGVICGAITSQYLLEK
SRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFR
RLLAAMEVLGFTSEDQDSIFRILASILHLGNVYFEKHETDAQEVASVVSAREIQAVAELL
QVSPEGLQKAITFKVTETIREKIFTPLTVESAVDARDAIAKVLYALLFGWLITRVNALVS
PKQDTLSIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQMDWR
EIAFADNQPCINLISLKPYGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPL
PEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVHSRTRVVAHLFSSHAAQTAPPRLG
KSSSITRLYKAHTVAAKFQQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVMMAQL
RYSGVLETVRIRKEGFPVRLPFQVFIDRYRCLVALKLNVPADGDMCVSLLSRLCTVTPDM
YRVGISKLFLKEHLHQLLESMRERVQNRAALTLQRYLRGFFIQRHFRSLRRKIILLQSRA
RGFLARQRYQQMRQSLLKFRSLVHTYVNRRRYLKLRAEQRRRAQEAWLREQEELSKREVV
PVRHLEVPAEVAGLLQAAAGLKLSSGPRVAVVRAPRLQAEPCVTLPLDINNYPMAKFIRC
HFKEPSFGMLTVPLKMPLTRLPVEHHAEAISVFKLILRFMGDPHLHGTQEMILGNYIVHQ
GLVEPALRDEILAQLANQVWRNPNAYNSKRGWLLLAACLSGFAPSPHLDKFLLKFVSDYG
QNGFQAVCQHRLLQAMGSGAARTFPPTQLEWTAIQEKASMALDVSCFNGDQFSCPVHTWS
TGEAVAGDILKHRGLADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLELLRDFPRQKSY
FIVGAEGPLAGRGDTRGVFGNCWDSDEDTPTRPQPQDHVAKMPDLDGYCSHKEDGTNGET
EAQRWTSNRQAVDSIGESTVPPRELDGYLDSLFDPVLACGDADLEKPTAIAYRMKGGGQP
GGGGGSTSEDTSRRPPEPKLKPIPGLDASTLALQQAFIHRQAVLLAREMTLQALALQQQP
LSATSRPQLPERPLAPEARPKTVVGTGPPAKPVLVRPTPQSWAPGSVAKAPKIPSKPVAV
PILAQDWTAPESISASPELVRYSTLNSEHFPQPTQQIRSIIKQYKQPPWAGHPEARRTDG
GKVFRRPPDPHEEALMILKGQKTQLAVVPGTQVSREAVAMVKPVTSAPRPCMGPTPVQPS
RSLEPPEDPVQTQLHRLVNPNFYGYQDIPWRIFLRKEVFYPKDNYSHPVQLDLLFRQILH
DTFSEACLRISEDERLQMKALFAQNQLDTQRPLVTESVKRAAISMARDSWEIYFSRLFPA
MGSVGTGVQILAVSHTGIKLLQMVKGSKEASRRLRVLCAYSFADILFVTMPSQNMLEFNL
SNEKLILFSARAQQVKTLVDTFILELKKDSDYVVAVRNFLSEDPELLSFHKGDIIHLQSL
EPTRVGYSAGCVVRKKLVYLEELRRRGPDFGWRFGAVHGRVGRFPSELVQPAAAPDFLQL
PAEPGRGRAAAVAAAVASAAAAQEVGRRREGPPVRARSADSGEDSIALPPSTMLEFAQKY
FRDPRRRPRDGLKLKSKEDRESKTLEDVLCFTKVPIQESLIELSDSNLNKMAVDMFVAVM
RFMGDAPLKGQSELDVLCTLLKLCGDHEVMRDECYCQIVKQITDNSSPKQDSCQRGWRLL
YIMAAYYSCSEVFYPYLIRFLQHVSWTPGLPFQGIAKACEQNLQKTLRFGGRLEFPSNME
LRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVIEGLCTEMALTRPEAFDEYVIFVV
TNRGQHVCPLSCRAYILDVASEMEQVDGGYTLWFRRVLWDQPLKFENELYVTMHYNQVLP
DYLKGLFSSVPARQPTEQQLQQVSKLASLQHRAKDHFYLPSVREVQEYIPAQLYHTTAGD
TWLNLVSQHRQQTQALSPHQARAQFLGLLSAFPLFGSSFFFIQSCSNVLVPAPCILAVNH
NGLNFLSTKTHELIVKIPLKEIQSTWTQQPTANSSYPYVEISLGDVAAQRTMQLQLEQGL
ELCRVVAVHVESMLSAREERLTLPPSEITLL
Download sequence
Identical sequences Q9QZZ4
NP_034992.2.92730 XP_017169821.1.92730 10090.ENSMUSP00000071777 ENSMUSP00000071777 ENSMUSP00000071777 ENSMUSP00000071777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]