SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000071836 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000071836
Domain Number 1 Region: 357-618
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.05e-80
Family Protein kinases, catalytic subunit 0.0000000203
Further Details:      
 
Domain Number 2 Region: 5-146
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-47
Family Pleckstrin-homology domain (PH domain) 0.000028
Further Details:      
 
Domain Number 3 Region: 214-345
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-29
Family SH2 domain 0.0000231
Further Details:      
 
Domain Number 4 Region: 155-240
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-18
Family SH3-domain 0.0000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000071836   Gene: ENSMUSG00000029217   Transcript: ENSMUST00000071944
Sequence length 630
Comment pep:known chromosome:NCBIM37:5:73146957:73259691:-1 gene:ENSMUSG00000029217 transcript:ENSMUST00000071944
Sequence
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSVLSYYEGRAEKKYRKGVIDISKIK
CVEIVKNDDGVIPCQNKFPFQVVHDANTLYIFAPSPQSRDRWVKKLKEEIKNNNNIMIKY
HPKFWADGSYQCCRQTEKLAPGCEKYNLFESSIRKTLPPAPEIKKRRPPPPIPPEEENTE
EIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYGSEGYIPSNYVTGKKSNN
LDQYEWYCRNTNRSKAEQLLRTEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYH
IKETATSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSTKGKNAPTTAGFSYD
KWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLT
HPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDMLLSMCQDVCEGMEYLE
RNSFIHRDLAARNCLVNEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSR
FSSKSDVWSFGVLMWEIFTEGRMPFEKNTNYEVVTMVTRGHRLHRPKLASKYLYEVMLRC
WQERPEGRPSFEDLLRTIDELVECEETFGR
Download sequence
Identical sequences Q3U436
NP_001106931.1.92730 NP_001106935.1.92730 XP_006503908.1.92730 XP_006503909.1.92730 XP_011239020.1.92730 XP_011239021.1.92730 mmt010007550.1 ENSMUSP00000071836 10090.ENSMUSP00000071836 ENSMUSP00000071836 ENSMUSP00000109224 ENSMUSP00000071836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]