SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000072642 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000072642
Domain Number 1 Region: 435-673,705-772
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.74e-57
Family Diacylglycerol kinase-like 0.019
Further Details:      
 
Domain Number 2 Region: 5-98,128-155
Classification Level Classification E-value
Superfamily EF-hand 6.21e-42
Family EF-hand modules in multidomain proteins 0.0014
Further Details:      
 
Domain Number 3 Region: 130-220
Classification Level Classification E-value
Superfamily EF-hand 3.81e-21
Family Calmodulin-like 0.0095
Further Details:      
 
Domain Number 4 Region: 225-294
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.97e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 
Domain Number 5 Region: 298-361
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000404
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000072642   Gene: ENSMUSG00000036095   Transcript: ENSMUST00000072865
Sequence length 801
Comment pep:known chromosome:NCBIM37:12:38607292:39359997:1 gene:ENSMUSG00000036095 transcript:ENSMUST00000072865
Sequence
MTNQEKWAHLSPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKYNPEGKQQVDQTIDFE
GFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPNVKSKPALLSGGLRMNKGAITPPRS
SPANTCSPEVIHLKDIVCYLSLLERGRPEDKLEFMFRLYDTDGNGFLDSSELENIIGQMM
HVAEYLEWDVTELNPILHEMMEEIDYDRDGTVSLEEWIQGGMTTIPLLVLLGLENNVKDD
GQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKSK
KNTDVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQTTLHNKCASHLKPECDCGP
LKDHILPPTTICPVVLTMPSAGASVPEERQSTAKKEKSSSQQPNKATDKNKMQRANSVTM
DGQGLQITPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGLHFF
RDVPDFRVLACGGDGTVGWILDCIEKANVVKHPPVAILPLGTGNDLARCLRWGGGYEGEN
LMKILKDIESSTEIMLDRWKFEVTPNDKDEKGDPVPYSIINNYFSIGVDASIAHRFHIMR
EKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIAILN
IPSMHGGSNLWGESKKKRSHRRIEKKGSDKRPTLTDAKELKFASQDLSDQLLEVVGLEGA
MEMGQIYTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKITHKNQAPMLMG
PPPKTGLFCSLIKRTRNRSKE
Download sequence
Identical sequences ENSMUSP00000072642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]