SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000072863 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000072863
Domain Number 1 Region: 5-326,439-471
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.83e-47
Family FAD-linked reductases, N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 311-421
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.35e-23
Family L-aminoacid/polyamine oxidase 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000072863   Gene: ENSMUSG00000062729   Transcript: ENSMUST00000073120
Sequence length 477
Comment pep:known chromosome:NCBIM37:1:173207123:173211317:-1 gene:ENSMUSG00000062729 transcript:ENSMUST00000073120
Sequence
MGRTVIVLGGGISGLAASYHLIRGPSPPKVILVEGSKRLGGWIRSIRGSDGAIFELGPRG
IRPAGALGARTLLLVSELGLESEVLPVRGDHPAAQNRFLYVGGTLHPLPSGLRGLLRPSP
PFSKPLFWAGLRELLKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGQSPQPDSSLIRQARAERWSQWSLRGGLEVLPQAL
HNHLASKGVTVLSGQPVCGLSLQPEGRWKVSLGDSSLEADHIISAIPASELSKLLPAEAA
PLARILSTIKAVSVAVVNLQYRGACLPVQGFGHLVPSSEDPTVLGIVYDSVAFPEQDGNP
PSLRVTVMLGGYWLQKLKAAGHQLSPELFQQQAQEAAATQLGLKEPPSHCLVHLHKNCIP
QYTIGHWQKLDSAMQFLTAQRLPLTLAGASYEGVAVNDCIESGRQAAVAVLGTESNS
Download sequence
Identical sequences P51175
ENSMUSP00000072863 ENSMUSP00000072863 10090.ENSMUSP00000072863 NP_032937.1.92730 XP_006496770.1.92730 ENSMUSP00000072863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]