SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000072932 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000072932
Domain Number 1 Region: 96-769
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.2e-253
Family Neutral endopeptidase (neprilysin) 0.000000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000072932   Gene: ENSMUSG00000057530   Transcript: ENSMUST00000073194
Sequence length 769
Comment pep:known chromosome:NCBIM37:4:137469497:137521140:1 gene:ENSMUSG00000057530 transcript:ENSMUST00000073194
Sequence
MRTVWSPLAAALAALGMSTYKRATLDEEDLVDSLSEGDVYPNGLQVNFRSSRSGQRCWAA
RTSVEKRLVVLVTLLAAGLVACLAALGIQYQTRTPPVCLTEACVSVTSSILNSMDPTVDP
CQDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAVIKHLLENATASVSEAERKAQVY
YRACMNETRIEELRAKPLMELIEKLGGWNITGPWAKDNFQDTLQVVTAHYRTSPFFSVYV
SADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNYMVQLGKLLGGGDEDAIR
PQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLPFLNTIFYPVEI
NESEPIVVYDKEYLRQVSTLINNTDKCLLNNYMMWNLVRKTSSFLDQRFQDADEKFMEVM
YGTKKTCIPRWKFCVSDTENNLGFALGPMFVKATFAEDSKNIASEIIMEIKKAFEESLST
LKWMDEETRRSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFS
WRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPNALNFGGI
GVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKQQTECMVQQYSNYSVNGEPVNG
RHTLGENIADNGGLKAAYRAYQNWVKKNGAEQTLPTLGLTSNQLFFLGFAQVWCSVRTPE
SSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPHHKCEVW
Download sequence
Identical sequences Q4PZA2
ENSMUSP00000072932 10090.ENSMUSP00000072932 XP_006538828.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]