SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000073534 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000073534
Domain Number 1 Region: 36-203
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-41
Family Dual specificity phosphatase-like 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000073534   Gene: ENSMUSG00000063821   Transcript: ENSMUST00000073870
Sequence length 215
Comment pep:known chromosome:NCBIM37:14:22495804:22533798:-1 gene:ENSMUSG00000063821 transcript:ENSMUST00000073870
Sequence
MASGDTKTSVKHAHLCAERLSVREEEGDAEDYCTPGAFELERLFWKGSPQYTHVNEVWPR
LHIGDEATALDRYGLQKAGFTHVLNAAHGRWNVDTGPDYYRDMAIEYHGVEADDVPTFDL
SIFFYSAAAFIDSALRDDHSKILVHCAMGRSRSATLVLAYLMIHKNMTLVDAIQQVAKNR
CVLPNRGFLKQLRELDKQLVKQRRQAGPGDSDLGL
Download sequence
Identical sequences Q8BK84
ENSMUSP00000073534 NYSGXRC-8737b 10090.ENSMUSP00000073534 ENSMUSP00000073534 ENSMUSP00000073534 NP_001013848.1.92730 XP_006519280.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]