SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000074047 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000074047
Domain Number 1 Region: 4452-4578
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 3.57e-23
Family HEPN domain 0.005
Further Details:      
 
Domain Number 2 Region: 89-292
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.13e-22
Family Heat shock protein 90, HSP90, N-terminal domain 0.041
Further Details:      
 
Domain Number 3 Region: 1454-1643
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.46e-18
Family Heat shock protein 90, HSP90, N-terminal domain 0.043
Further Details:      
 
Domain Number 4 Region: 2523-2706
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.82e-17
Family Heat shock protein 90, HSP90, N-terminal domain 0.054
Further Details:      
 
Domain Number 5 Region: 4306-4372
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000000000353
Family Chaperone J-domain 0.000024
Further Details:      
 
Domain Number 6 Region: 5-70
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000771
Family Ubiquitin-related 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000074047   Gene: ENSMUSG00000048279   Transcript: ENSMUST00000074447
Sequence length 4582
Comment pep:known chromosome:NCBIM37:14:61783570:61833092:1 gene:ENSMUSG00000048279 transcript:ENSMUST00000074447
Sequence
MNTQLSRWVRVTVLRGCVGCRTVAVPATATGRDLKERIFAETSFPVAEQRLWRGDREIPD
WIKIGDLTSKTCHLFVNLQSKGLKGGGRFGQTTPPLVDFLKDILRRYPEGGQILKELIQN
AEDAGATEVKFLYDETQYGTETLWSKDMAQYQGSALYVYNNAVFTPEDWHGIQEIARSRK
KDDPLKVGRFGIGFNSVYHITDVPCIFSGDQIGMLDPHQTLFGPHESGQCWNLKDDIKEI
NELPDQFAPFIGVFGSTKETFTNGSFPGTFFRFPLRLQPSQLSSNLYTKQKVLELFDSFR
ADADTVLLFLKSVQAVSLHVREADGTEKLVFRVTASENKALKHERPNSIKILGTAISNYC
KKIPSNSVTCVTYHINIVLEDESTKDAQKTSWLVCNSVGGRGISSKLDSLADELKFVPII
GLAMPLSGKDEENGAISDFSGKAFCFLPLPPGEESRTGLPVHISGFFGLTDNRRSIKWRE
LDQWRDPAALWNEYLIVNVVPKTYATLILDSIKRLETEKSSDFPLSVDTIYKLWPEASKV
KAHWHPVLGPLFSELFQHAVIYSIGGEWVKLEQVHFSELDGSLESTRSVLNYLQSSGKQI
AKVPGNLAAAVQLSAASATSSASPVRKVTPAWVRQVLRKCAHLGSAEEKLHLLEFVLSDQ
AYSELLGLELLPLQSGAFVPFSSSVSDQDVVYITSEEFPRSLFPGLEARLILENLKPHLL
AALKEAAQTRGRPCTQLQLLNPERFARLIKEVMNTFWPGRELVVQWYPFSEDKRHPSLSW
LKMVWKNLYIHFSEDLTLFDEMPLIPRTLLNEDQTCVELIRLRIPSVVILDDETEAQLPE
FLADIVQKLGGIVLKRLDTSIQHPLVKKYIHSPLPSAILQIMEKIPLQKLCNQIASLLPT
HKDALRKFLASLTDTSEKEKRIIQELTIFKRINHSSDQGISSYTKLKGCKVLDHTAKLPT
DLRLSVSVIDSSDEATIRLANMLKIEKLKTTSCLKFVLKDIGNAFYTQEEVTQLMLWILE
NLSSLKNENSNVLDWLMPLKFIHMSQGHVVAAGDLFDPDIEVLRDLFYNEEEACFPPTIF
TSPDILHSLRQIGLKNESSLKEKDVVQVARKIEALQVSSCQNQDVLMKKAKTLLLVLNKN
QTLLQSSEGKMALKKIKWVPACKERPPNYPGSLVWKGDLCNLCAPPDMCDAAHAVLVGSS
LPLVESVHVNLEQALSIFTKPTINAVLKHFKTVVDWYTSKTFSDEDYYQFQHILLEIYGF
MHDHLSEGKDSFKALKFPWVWTGKNFCPLAQAVIKPTHDLDLQPYLYNVPKTMAKFHQLF
KACGSIEELTSDHISMVIQKVYLKSDQELSEEESKQNLHLMLNIMRWLYSNQIPASPNTP
VPIYHSRNPSKLVMKPIHECCYCDIKVDDLNDLLEDSVEPIILVHEDIPMKTAEWLKVPC
LSTRLINPENMGFEQSGQREPLTVRIKNILEEYPSVSDIFKELLQNADDANATECSFMID
MRRNMDIRENLLDPGMAACHGPALWSFNNSEFSDSDFLNITRLGESLKRGEVDKVGKFGL
GFNSVYHITDIPIIMSREFMIMFDPNINHISKHIKDRSNPGIKINWSKQQKRLRKFPNQF
KPFIDVFGCQLPLAVEAPYSYNGTLFRLSFRTQQEAKVSEVSSTCYNTADIYSLVDEFSL
CGHRLIIFTQSVNSMYLKYLKIEETNPSLAQDTIIIKKKVCPSKALNAPVLSVLKEAAKL
MKTCSSSNKKLPTDVPKSSCILQITVEEFHHVFRRIADLQSPLFRGPDDDPATLFEMAKS
GQSKKPSDELPQKTVDCTTWLICTCMDTGEALKFSLNESGRRLGLVPCGAVGVLLHETQE
QKWTVKPHIGEVFCYLPLRIKTGLPIHINGCFAVTSNRKEIWKTDTKGRWNTTFMRHVIV
KAYLQALSVLRDLAIGGELTDYTYYAVWPDPDLVHDDFSVICKGFYEDIAHGKGKELTRV
FSDGSMWVSMKNVRFLDDSILQRKDVGSAAFKIFLKYLKKTGSKNLCAVELPSSVKAGFE
EAGCKQILLENTFSEKQFFSEVFFPNIQEIEAELRDPLMNFVLNEKLDEFSGILRVTPCV
PCSLEGHPLVLPSRLIHPEGRVAKLFDTKDGRFPYGSTQDYLNPIILIKLVQLGMAKDDI
LWDDMLERAESVAEINKSDHAAACLRSSILLSLIDEKLKIKDPRAKDFAAKYQTIPFLPF
LTKPAGFSLEWKGNSFKPETMFAATDIYTAEYQDIVCLLQPILNENSHSFRGCGSVSLAV
KEFLGLLKKPTVDLVINQLKQVAKSVDDGITLYQENITNACYKYLHEAVLQNEMAKATII
EKLKPFCFILVENVYVESEKVSFHLNFEAAPYLYQLPNKYKNNFRELFESVGVRQSFTVE
DFALVLESIDQERGKKQITEENFQLCRRIISEGIWSLIREKRQEFCEKNYGKILLPDTNL
LLLPAKSLCYNDCPWIKVKDSTVKYCHADIPREVAVKLGAIPKRHKALERYASNICFTAL
GTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQNADDAKATEICFVFDPRQHPVDRIFDD
KWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGTKEGNPCKTGQYGIGFNSVYHITDCPSF
ISGNDILCIFDPHARYAPGATSVSPGRMFRDLDADFRTQFSDVLDLYLGNHFKLDNCTMF
RFPLRNAEMAQVSEISSVPSSDRMVQNLLDKLRSDGAELLMFLNHMEKISICEIDKATGG
LNVLYSVKGKITDGDRLKRKQFHASVIDSVTKKRQLKDIPVQQITYTMDTEDSEGNLTTW
LICNRSGFSSMEKVSKSVISAHKNQDITLFPRGGVAACITHNYKKPHRAFCFLPLSLETG
LPFHVNGHFALDSARRNLWRDDNGVGVRSDWNNSLMTALIAPAYVELLIQLKKRYFPGSD
PTLSVLQNTPIHVVKDTLKKFLSFFPVNRLDLQPDLYCLVKALYSCIHEDMKRLLPVVRA
PNIDGSDLHSAVIITWINMSTSNKTRPFFDNLLQDELQHLKNADYNITTRKTVAENVYRL
KHLLLEIGFNLVYNCDETANLYHCLVDADIPVSYVTPADVRSFLMTFSSPDTNCHIGKLP
CRLQQTNLKLFHSLKLLVDYCFKDAEESEFEVEGLPLLITLDSVLQIFDGKRPKFLTTYH
ELIPSRKDLFMNTLYLKYSSVLLNCKVAKVFDISSFADLLSSVLPREYKTKNCAKWKDNF
ASESWLKNAWHFISESVSVTDDQEEPKPAFDVIVDILKDWALLPGTKFTVSTSQLVVPEG
DVLIPLSLMHIAVFPNAQSDKVFHALMKAGCIQLALNKICSKDSALVPLLSCHTANIDSP
ASILKAVHYMVQTSTFRTEKLMENDFEALLMYFNCNLSHLMSQDDIKILKSLPCYKSISG
RYMSIAKFGTCYVLTKSIPSAEVEKWTQSSSSAFLEEKVHLKELYEVLGCVPVDDLEVYL
KHLLPKIENLSYDAKLEHLIYLKNRLASIEEPSEIKEQLFEKLESLLIIHDANNRLKQAK
HFYDRTVRVFEVMLPEKLFIPKEFFKKLEQVIKPKNQAAFMTSWVEFLRNIGLKYALSQQ
QLLQFAKEISVRANTENWSKETLQSTVDILLHHIFQERMDLLSGNFLKELSLIPFLCPER
APAEYIRFHPQYQEVNGTLPLIKFNGAQVNPKFKQCDVLQLLWTSCPILPEKATPLSIKE
QEGSDLAPQEQLEQVLNMLNVNLDPPLDKVINNCRNICNITTLDEEMVKTRAKVLRSIYE
FLSAEKREFRFQLRGVAFVMVEDGWKLLKPEEVVINLEYEADFKPYLYKLPLELGTFHQL
FKHLGTEDIISTKQYVEVLSRIFKSSEGKQLDPNEMRTVKRVVSGLFKSLQNDSVKVRSD
LENARDLALYLPSQDGKLVKSSILVFDDAPHYKSRIQGNIGVQMLVDLSQCYLGKDHGFH
TKLIMLFPQKLRPRLLSSILEEQLDEETPKVCQFGALCSLQGRLQLLLSSEQFITGLIRI
MKHENDNAFLANEEKAIRLCKALREGLKVSCFEKLQTTLRVKGFNPIPHSRSETFAFLKR
FGNAVILLYIQHSDSKDINFLLALAMTLKSATDNLISDTSYLIAMLGCNDIYRISEKLDS
LGVKYDSSEPSKLELPMPGTPIPAEIHYTLLMDPMNVFYPGEYVGYLVDAEGGDIYGSYQ
PTYTYAIIVQEVEREDADNTSFLGKIYQIDIGYSEYKIVSSLDLYKFSRPDESSQNRDSA
PTTPTSPTEFLTPGLRSIPPLFSGKESHKSPSTKHHSPRKLKVNALPEILKEVTSVVEQA
WKLPESERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLEKQAFLDQNADRASR
RTFSTSASRFQSDKYSFQRFYTSWNQEATSHKSERQQQSKEKCPPSAGQTYSQRFFVPPT
FKSVGNPVEARRWLRQARANFSAARNDLHKNANEWVCFKCYLSTKLALIAADYAVRGKSD
KDVKPTALAQKIEEYSQQLEGLTNDVHTLEAYGVDSLKTRYPDLLPFPQIPNDRFTSEVA
MRVMECTACIIIKLENFIQQKV
Download sequence
Identical sequences 10090.ENSMUSP00000074047 ENSMUSP00000074047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]