SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000074255 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000074255
Domain Number 1 Region: 218-308
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 2.09e-23
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0015
Further Details:      
 
Domain Number 2 Region: 385-466
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000436
Family UBX domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000074255
Domain Number - Region: 72-147
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00418
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000074255   Gene: ENSMUSG00000012126   Transcript: ENSMUST00000074690
Sequence length 484
Comment pep:known chromosome:NCBIM37:4:133658498:133682691:1 gene:ENSMUSG00000012126 transcript:ENSMUST00000074690
Sequence
MSSPLASLSKTRKVPLESESVNPGRRGIRVYGNEDEVDMWNDGQDSEEKISLPSCYGGIG
APVSRQGPHDSELMASMTRKLQELEQQLQAQNDEMLSKERKILDLEDLVQTLQQHQNNAA
LQRQEELETQCIQLQRQIGEMERFLSDYGLQWVGEPMDQENSEEKTVSENDERDWMKAKK
FWKPGDSFVPPEVDFDKLMASLQDLSELVEGEAQVTPVPGGARFRTLEPIPLKVYRNGIM
MFDGPFRPFYDPSTQRCLRDILDGFFPSELQRLYPDGVPFKVSDLRNQIYPEDGLGQFPG
EGRVVGRQKMRKVTDRVEETSGSRMTAEQFLNRLPKCIIRQGEVIDIRGPIRDTLQNCCP
MPARIQEIIVETPALASERQRSQESPDMPMPLLSMLRIKSENGEQAFLLMMWPEDTIGDV
RKLLAQARDMDSAAFEILSTFPPTVYQDDTVTLQAAGLVPNATLLLRTRRALLSNPISRP
GSLP
Download sequence
Identical sequences Q9D572
ENSMUSP00000064030 NP_080533.1.92730 ENSMUSP00000074255 10090.ENSMUSP00000074255 ENSMUSP00000074255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]