SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000074290 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000074290
Domain Number 1 Region: 329-462,759-934
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.23e-53
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 61-184
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-28
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 3 Region: 231-299
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.08e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000483
Further Details:      
 
Domain Number 4 Region: 170-226
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000374
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000074290   Gene: ENSMUSG00000034731   Transcript: ENSMUST00000074729
Sequence length 1156
Comment pep:known chromosome:NCBIM37:14:78969416:79124896:-1 gene:ENSMUSG00000034731 transcript:ENSMUST00000074729
Sequence
MAGAGSQHHPQGVAGGAVAGASAVSPTAAGPGEDSSDSEAEQEGPQKLIRKVSTSGQMRT
KTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEASTKNA
NNSFTIITPFRRLMLCAENRKEMEVWISSLKSVQSREPYEVAQFNVEHFSGMHNWYACSH
ARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDG
VAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDVYHPVCPLGQC
KVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVF
DLMNGGPYLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLHKQCQLGVLPLGTGNDL
ARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPAKSSLLPEPVAATEEF
YMTIYEDSVANHLTKIVNSDEHAVVISSAKILCETVKDFVAKVEKAQDRTLENTVVAEAV
ASKCSVLNEKLEQLLQALHADSQASRVPPGIGPAIPEEDTVESASDESLGESKDQLVNDI
GKPSSQKAVKPREIMLRANSLKKAVRQVIEEAEKVMDEPAVQPSEPVSPSCDYDTETDEA
KEDDAKESLSAKTTSQSPDAQASCGHPQTDSVAGPAMATTKENLPVLNTRIICPGLRAGL
AASIAGSSIINKMLLANIDPFGATPFIDPDLDSLDGYSEKCVMNNYFGIGLDAKISLEFN
NKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLPSLQGIAVL
NIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAVFDSVQMAVSRVIKLQHHRIAQCRT
VKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWEDKQKCDSG
KPVLRTNLYIHPAPDLATEEVSQMRLCSQAAEELITRICDAATIHCLLEQELAHAVNACS
HALNKANPRFPESLTRDTATEIAINVKALYNETEALLVGRVPLHLESPHEERVSSALHSV
EMELQKLTEIPWLYYILRPSEDEEPPLDCTKRNNKSTVFRIVPKFKKEKAQKQKTSSQPG
PGDSESGSYEANSPGN
Download sequence
Identical sequences D3YXJ0
ENSMUSP00000074290 ENSMUSP00000074290 ENSMUSP00000074290 NP_001074805.1.92730 10090.ENSMUSP00000074290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]