SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000074352 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000074352
Domain Number 1 Region: 620-916
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.08e-84
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000695
Further Details:      
 
Domain Number 2 Region: 912-1263
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.24e-67
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000868
Further Details:      
 
Domain Number 3 Region: 384-551
Classification Level Classification E-value
Superfamily Fibronectin type III 5.89e-18
Family Fibronectin type III 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000074352
Domain Number - Region: 287-350
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0537
Family Fibronectin type III 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000074352   Gene: ENSMUSG00000026395   Transcript: ENSMUST00000074797
Sequence length 1341
Comment pep:known chromosome:NCBIM37:1:139959438:140071882:-1 gene:ENSMUSG00000026395 transcript:ENSMUST00000074797
Sequence
MGLWLKLLAFGFALLDTEVFVTGQTPTPSDELSTTENALLLPQSDPLPARTTESTPPSIS
ERGNGSSETTYHPGVLSTLLPHLSPQPDSQTPSAGGADTQTFSSQADNPTLTPAPGGGTD
PPGVPGERTVPGTIPADTAFPVDTPSLARNSSAASPTHTSNVSTTDISSGASLTTLTPST
LGLASTDPPSTTIATTTKQTCAAMFGNITVNYTYESSNQTFKADLKDVQNAKCGNEDCEN
VLNNLEECSQIKNISVSNDSCAPATTIDLYVPPGTDKFSLHDCTPKEKANTSICLEWKTK
NLDFRKCNSDNISYVLHCEPENNTKCIRRNTFIPERCQLDNLRAQTNYTCVAEILYRGVK
LVKNVINVQTDLGIPETPKPSCGDPAARKTLVSWPEPVSKPESASKPHGYVLCYKNNSEK
CKSLPNNVTSFEVESLKPYKYYEVSLLAYVNGKIQRNGTAEKCNFHTKADRPDKVNGMKT
SRPTDNSINVTCGPPYETNGPKTFYILVVRSGGSFVTKYNKTNCQFYVDNLYYSTDYEFL
VSFHNGVYEGDSVIRNESTNFNAKALIIFLVFLIIVTSIALLVVLYKIYDLRKKRSSNLD
EQQELVERDDEKQLMDVEPIHSDILLETYKRKIADEGRLFLAEFQSIPRVFSKFPIKDAR
KPHNQNKNRYVDILPYDYNRVELSEINGDAGSTYINASYIDKFGFKEPRKYIAAQETWPR
DETVDDFWRMIWEQKATVIVMVTRCEEGNRCVCVCNKCAEYWPSMEEGTRAFKDIVVTIN
DHKRCPDYIIQKLNVAHVTQKKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNA
FSNFFSGPIVVHCSRPVSVAGVGRTGTYIGIDAMLEGLEAEGKVDVYGYVVKLRRQRCLM
VQVEVQSYYAQYILIHQALVEYNQFGETEVNLSELHSCLHNMKKRDPPSDPSPLEAEYQR
KRLNRLPSYRSWRTQHIGNQEENKKKNRNSNVVPYDFNRVPLKHELEMSKESEPESDESS
DDDSDSEETSKYINASFVMCYCFYWKPEMMIAAQGPLKETIGDFWQMIFQRKVKVIVMLT
ELVNGDQDQDICEVCAQYWGEGKQTYGDMEVEMKDTNRASAYTLRTFELRHSKKKKCRKE
PRTVYQYQCTTWKGEELPAEPKDLVSMIQDLKQKLPKASPEGMKYHKHASILVHCRTVSF
LDGSQQTGLFCALFNLLESAETEDVVDVFQVVKSLRKARPGVVCSYNMSEHEQYQFLYDI
IASIYPAQNGQVKKTNSQDKIEFHNEVDGGKQDANCVRPDGPLNKAQEDSRGVGTPEPTN
SAEEPEHAANGSASPAPTQSS
Download sequence
Identical sequences ENSMUSP00000074352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]