SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000074594 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000074594
Domain Number 1 Region: 281-461
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-65
Family SPRY domain 0.00000991
Further Details:      
 
Domain Number 2 Region: 8-83
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 87-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000074594   Gene: ENSMUSG00000037124   Transcript: ENSMUST00000075084
Sequence length 485
Comment pep:known chromosome:NCBIM37:11:58453967:58465906:1 gene:ENSMUSG00000037124 transcript:ENSMUST00000075084
Sequence
MATAPGERLQEEARCSVCLDFLQEPISVDCGHSFCLRCISEFCEKSDSAQGVYACPQCRG
PFRPASFRPNRQLASLVDSVRQLGLGTGHAGSRQCARHGEDLSHFCEEDQTMLCWVCDTS
PEHRSHRTETLQEAASRYQRMLRASLELVKKEMEEALTQEANVGKKTIIWKEKVEMQRQR
FRLEFEKHRGFLAQEEQLQLRRLEEEERATLQRLRDSRNRLAQQNKALKELAEELEERSQ
RPAPGLLEGARGVLTRCEAITRLEPEAVPMDLKTVCRIPGMREMLRKFQVDVKLDPATAH
PSLLLTADLRSVQDAEVWRDVPSNPERFDTWPCILGLQGFSSGRHYWEVIVGERAEWGLG
VCRDSVLRKGETTPSPENGVWAMWLLRGNEYMVLSSPSVPVLQDERPRRIGIFLDYEAGE
ISFYNVTNGSYIYTFNHLFSGVLRPYFFVCDTTPLILPPMTEAAPGNWTPRGIFDLAAAA
RNEEY
Download sequence
Identical sequences Q5NCC9
ENSMUSP00000074594 NP_001034136.1.92730 ENSMUSP00000074594 10090.ENSMUSP00000074594 ENSMUSP00000074594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]