SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000074726 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000074726
Domain Number 1 Region: 1217-1357
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-32
Family Synaptotagmin-like (S variant) 0.062
Further Details:      
 
Domain Number 2 Region: 2040-2170
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.21e-21
Family Synaptotagmin-like (S variant) 0.014
Further Details:      
 
Domain Number 3 Region: 1085-1143
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000329
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000074726   Gene: ENSMUSG00000062151   Transcript: ENSMUST00000075245
Sequence length 2210
Comment pep:known chromosome:NCBIM37:9:73328677:73781374:-1 gene:ENSMUSG00000062151 transcript:ENSMUST00000075245
Sequence
MVASLFKSLILAYIHKLCKGMFTKKLGNTTKKKENRQQKKDQDFPTAGHTKPPKLSNALK
STVKKIAKCSSTRNFSIEDEEGHKDFSLSPTFSYRVAIANGLQTAVTNSDEDLLQELSSI
ESSYSESFNELRSSTENQVQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHTLKLGALRK
LRKWKKSQECVSSDSELSTVKKTWGIRSKSLDRTARNPKTNVLEPGFSSSGCISQTHDVM
EMIFKELQGISQIETELSELRGHVNALKYSIDEISSSVEVVQSEIEQLRTGFVQARRETR
DIHDYIKHLGHMGSKVSLRFLNVPEERHEYVESVVYQILIDKMGFSDVPNAIKIEFAQRI
GQQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTYDIRERKEKGVLP
SSQTYESMDMKLSTPEPKAKKNAWLSPNDSDRELESDLSRSSYADSPAKGSSSKSSSKSH
SARSKNKAANSRTSQKSDYNKRPSQPPASSTPEKQTPHYVEATPPLWHSQSDFFTLKLSR
SESDFSKLCQSYSEDFSESQFFCRTNGSSLLSSSDRELWQRKQEGMPALYHRLQDQGLDE
TIPAVPGQAEIENTETVDSGMSNSMVCASGDRSNYSGSQLSLHEDLSPWKEWNQAGQGTD
DVGLDSSTQEPFDYDTNSLSDQQLDLSSKDLDDLGKCHSDLQDDSESYDLTQDDNSSPCP
GLDNEPQGQWVGQYDSYQEANSNDLYPNQSHPSMMYRSQSELQSDDSEGAQPKSWHSRLS
IDLSDKTFKFPKFGSTLQRAKSALEVVWNKSTQSLSGCEDSGSSLMGRFRTLSQSTANES
STTLDSDIYTEPYYYKAEEEEDYCEPVADSETDYVEVMEQVLAKLENRTSITEVNEHIKD
YDHPSYETPYETPQDEGYDGQADDIISEGELETLNEPAVEMELAEDENQNLPAESLEVMK
PKRIRPSFKEAALRAYKKQMAELEEKILAGDSSSMDEKARIVSGNDLDASKFSALQVFGG
AGRGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKMHVFRKT
LQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQDLLN
ADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIRERNRPEVFEVIQEMFQISKEDFVQYT
KAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIFGNLN
PVWDEKFFFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRTLSGEMD
VWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVKSNGSVK
IPEVKGDEAWKVFFDDASQEIVDEFAMRYGVESIYQAMTHFSCLSSKYMCPGVPAVMSAL
LANINAFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYRENFPAS
NSERLQDLKSTVDLLTSITFFRMKVLELQSPPKASAVVKDCVRACLDSTYKYIFDNCHEL
YSQLIDPSKKQDVPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQELNMG
KISAEIMWSLFALDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKDAVPE
YSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDVFAQLNQSF
EIIKKLECPNPEALSHLMRRFAKTINKVLVQYAAIVSNDFSSYCDKETVPCILMNNIQQL
RVQLEKMFESMGGKELDPEASTILKELQIKLNGVLDALSITYGESFQLTIEECIKQMGAE
LNQMRANGNSTANKNSAAMDAEIVLRPLMDFLDKTLSLSAKICEKTVLKRVLKELWKLVL
NKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDAKGLTPRQCAIVEVVLAT
IKQYFHAGGNGLKKNFLEKSPDLHSLRYALSLYTQTTDALIKKFIETQGSQSRSSKDAVG
QISVHVDVTTTPGTGDHKVTVKVIAINDLNWQTTAMFRPFVEVCMLGPSLGDKKRKQGTK
TKSNTWSPKYNETFQFILGNENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIAEKGS
YGAWYPLLKNLSMDETGLTILRILSQRTSDDVAKEFVRLKSETRSIEESA
Download sequence
Identical sequences Q8K0T7
ENSMUSP00000074726 ENSMUSP00000074726 ENSMUSP00000074726 ENSMUSP00000139027 10090.ENSMUSP00000074726 NP_001074622.1.92730 XP_006510996.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]