SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000075094 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000075094
Domain Number 1 Region: 331-411
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000277
Family Ubiquitin-related 0.0035
Further Details:      
 
Domain Number 2 Region: 249-327
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000557
Family Ubiquitin-related 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000075094   Gene: ENSMUSG00000030722   Transcript: ENSMUST00000075671
Sequence length 412
Comment pep:known chromosome:NCBIM37:7:133526368:133540251:-1 gene:ENSMUSG00000030722 transcript:ENSMUST00000075671
Sequence
MAEPLRGRGPRSRGGRGARRARGARGRCPRARQSPARLIPDTVLVDLVSDSDEEVLEVAD
PVEVPVARLPAPAKPEQDSDSDSEGAAEGPAGAPRTLVRRRRRRLLDPGEAPVVPVYSGK
VQSSLNLIPDNSSLLKLCPSEPEDEADLTNSGSSPSEDDALPSGSPWRKKLRKKCEKEEK
KMEEFPDQDISPLPQPSSRNKSRKHTEALQKLREVNKRLQDLRSCLSPKQHQSPALQSTD
DEVVLVEGPVLPQSSRLFTLKIRCRADLVRLPVRMSEPLQNVVDHMANHLGVSPNRILLL
FGESELSPTATPSTLKLGVADIIDCVVLASSSEATETSQELRLRVQGKEKHQMLEISLSP
DSPLKVLMSHYEEAMGLSGHKLSFFFDGTKLSGKELPADLGLESGDLIEVWG
Download sequence
Identical sequences O09130
10090.ENSMUSP00000075094 ENSMUSP00000075094 ENSMUSP00000075094 NP_035030.2.92730 ENSMUSP00000075094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]