SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000075825 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000075825
Domain Number 1 Region: 32-391,432-458
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.36e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000075825   Gene: ENSMUSG00000060224   Transcript: ENSMUST00000076505
Sequence length 581
Comment pep:known chromosome:NCBIM37:19:42800348:42827265:-1 gene:ENSMUSG00000060224 transcript:ENSMUST00000076505
Sequence
MAAGGRGLIRALHSSPCPTWKRAQSGANGRLKPEYDAVVIGAGHNGLVAAAYLQRLGVNT
AVFERRHVIGGAAVTEEIIPGFKFSRASYLLSLLRPQICTDLELKKHGLKLHLRDPYSFT
PMLEEGTLNRLPRSLLLGTDMAANQKEISQFSRKDAQAFPRYEEFMKRLVLAIDPLLDAA
PVDTTAFQHGSLLQRLRALSTLKPLLKAGRTLGAQLPQYYEVLTAPISKVLDQRFESEPL
KATLATDAVIGAMTSPHTPGSGYVLLHHVMGSLEGTQGAWSYVQGGMGALSDAIASSAAT
RGASIFTEKTVAKVQVNSEGRAQGVTLQDGEEVRSRVVLSCASPQVTFLELTPQEWLPGA
FVKRISQLDTQSPVTKINVAVDRLPNFQAAPNAPGDQPQGHHQCSIHLNCEDTLLLHQAF
EDAKGGLPSQKPMIELCIPSSLDPTLAPPGCHVVSLFTQYTPYTLAGGKVWNEQEKNTYA
DKVFDCIEAYAPGFKRSVLARDILTPPDLERIFRLPGGNIFHGAMSLDQLYFARPVPQHS
DYRCPVQGLYLCGSGAHPGGGVMGAAGRNAAHVVFRDLKNM
Download sequence
Identical sequences Q3U4I7
ENSMUSP00000075825 10090.ENSMUSP00000075825 NP_083287.2.92730 ENSMUSP00000075825 ENSMUSP00000075825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]