SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000076189 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000076189
Domain Number 1 Region: 295-494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-37
Family SPRY domain 0.00035
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily RING/U-box 1.94e-27
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Domain Number 3 Region: 88-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.43e-17
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 4 Region: 119-241
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0000379
Family Apolipoprotein A-I 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000076189   Gene: ENSMUSG00000030921   Transcript: ENSMUST00000076922
Sequence length 496
Comment pep:known chromosome:NCBIM37:7:111557539:111613707:-1 gene:ENSMUSG00000030921 transcript:ENSMUST00000076922
Sequence
MASSVLEMIKEEVTCPICLELLKEPVSADCNHSFCRACITLNYESNRNTDGKGNCPVCRV
PYPFGNLRPNLHVANIVERLKGFKSIPEEEQKVNICAQHGEKLRLFCRKDMMVICWLCER
SQEHRGHQTALIEEVDQEYKEKLQGALWKLMKKAKICDEWQDDLQLQRVDWENQIQINVE
NVQRQFKGLRDLLDSKENEELQKLKKEKKEVMEKLEESENELEDQTELVRDLISDVEHHL
ELSTLEMLQGANCVLRRSQSLSLQQPQTVPQKRKRTFQAPDLKGMLQVYQGLMDIQQYWV
HMTLHARNNAVIAINKEKRQIQYRSYNTVPVSEIYHLGVLGYPALSSGKHYWEVDISRSD
AWLLGLNDGKCAQPQLHSKEEMGIKKNLHSQIKQNVLFQPKCGYWVIGMKNPSVYKAFDE
CSITHNSSILVISLPDRPSRVGVFLDRKAGTLSFYDVSNCGALIYRFYDPAFPVEVYPYF
NPMKCSEPMTICGPPS
Download sequence
Identical sequences P15533
10090.ENSMUSP00000076189 ENSMUSP00000076189 ENSMUSP00000076189 ENSMUSP00000076189 NP_033125.2.92730 XP_006507534.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]