SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000077544 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000077544
Domain Number 1 Region: 505-618
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-31
Family SH2 domain 0.000000657
Further Details:      
 
Domain Number 2 Region: 197-284
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.82e-28
Family Ras-binding domain, RBD 0.00025
Further Details:      
 
Domain Number 3 Region: 311-440
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000767
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000077544   Gene: ENSMUSG00000020176   Transcript: ENSMUST00000078449
Sequence length 621
Comment pep:known chromosome:NCBIM37:11:11833162:11937404:-1 gene:ENSMUSG00000020176 transcript:ENSMUST00000078449
Sequence
MNNDINSSVESLNSACNMQSDTDTAPLLEDGQHASNQGAASSSRGQPQASPRQKMQRSQP
VHILRRLQEEDQQLRTASLPAIPNPFPELTGAAPGSPPSVAPSSLPPPPSQPPAKHCGRC
EKWIPGENTRGNGKRKIWRWQFPPGFQLSKLTRPGLWTKTTARFSKKQPKNQCPTDTVNP
VARMPTSQMEKLRLRKDVKVFSEDGTSKVVEILTDMTARDLCQLLVYKSHCVDDNSWTLV
EHHPQLGLERCLEDHEIVVQVESTMPSESKFLFRKNYAKYEFFKNPVNFFPDQMVNWCQQ
SNGGQAQLLQNFLNTSSCPEIQGFLQVKEVGRKSWKKLYVCLRRSGLYYSTKGTSKEPRH
LQLLADLEESSIFYLIAGKKQYNAPNEHGMCIKPNKAKTEMKELRLLCAEDEQIRTCWMT
AFRLLKYGMLLYQNYRIPQRKGLPPPFNAPMRSVSENSLVAMDFSGQIGRVIDNPAEAQS
AALEEGHAWRKRSTRMNILSSQSPLHPSTLNAVIHRTQHWFHGRISREESHRIIKQQGLV
DGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFTLDDGNTKFSDLIQLVDF
YQLNKGVLPCKLKHHCIRVAL
Download sequence
Identical sequences Q60760
10090.ENSMUSP00000077544 XP_006514592.1.92730 ENSMUSP00000077544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]