SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000077741 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000077741
Domain Number 1 Region: 48-142
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.29e-21
Family SAM (sterile alpha motif) domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000077741   Gene: ENSMUSG00000058656   Transcript: ENSMUST00000078673
Sequence length 161
Comment pep:known chromosome:NCBIM37:15:53293356:53734085:-1 gene:ENSMUSG00000058656 transcript:ENSMUST00000078673
Sequence
MAVEALHCGLNPRGIDHSAHADGIKLQIEGEGVESQSIKNRTFQKVPDQKGTPKRLQGEA
ETAKSATVKLSKPVALWTQQDVCKWLKKHCPNQYQLYSESFKQHDITGRALLRLTDKKLE
RMGIAQENQRQHILQQVLQLKVREEVRNLQLLTQASVECSP
Download sequence
Identical sequences Q0VE29
NP_796199.1.92730 10090.ENSMUSP00000077741 ENSMUSP00000077741 ENSMUSP00000077741 ENSMUSP00000077741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]