SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000078715 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000078715
Domain Number 1 Region: 55-202
Classification Level Classification E-value
Superfamily EF-hand 2.32e-35
Family Calmodulin-like 0.00000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000078715   Gene: ENSMUSG00000059741   Transcript: ENSMUST00000079784
Sequence length 204
Comment pep:known chromosome:NCBIM37:9:110666150:110672308:1 gene:ENSMUSG00000059741 transcript:ENSMUST00000079784
Sequence
MAPKKPEPKKDDAKAAAPKAAPAPAAAPAAAPAAAPEPERPKEAEFDASKIKIEFTPEQI
EEFKEAFLLFDRTPKGEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDF
ETFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEK
LMAGQEDSNGCINYEAFVKHIMAS
Download sequence
Identical sequences P09542
ENSMUSP00000078715 ENSMUSP00000078715 NP_034989.1.92730 ENSMUSP00000078715 10090.ENSMUSP00000078715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]