SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000078985 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000078985
Domain Number 1 Region: 234-410
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.62e-26
Family Ankyrin repeat 0.00094
Further Details:      
 
Domain Number 2 Region: 519-631
Classification Level Classification E-value
Superfamily Second domain of FERM 8.5e-16
Family Second domain of FERM 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000078985   Gene: ENSMUSG00000000600   Transcript: ENSMUST00000080085
Sequence length 736
Comment pep:known chromosome:NCBIM37:5:3803165:3844515:1 gene:ENSMUSG00000000600 transcript:ENSMUST00000080085
Sequence
MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQS
NSEIAQGILDYVVETTKPISPANQGIKGKRVVLMRKFPLDGEKTGREAALFIVPSVVKDN
TKYAYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYAAELGQVDNSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVVEDKERQWVDDFPLHRNACEGD
SELLSHLLDKGLSVNQLDNDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLTHPDIDRHITDQQGRSPLNVCEENKQNNWEEAAKLLKDAINKPYE
KVRIYRMDGSYRSVELKHGNNTTAQQIMEGMRLSQETQRYFTIWICSENLSLQFKPYHKP
LQQVHDWPEILAELTNLDPQRETPQLFLRRDVGLPLEVEKKIEDPLAILILFDEARYNLL
KGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEETLKSIVPITKLKSKAPHWINR
ILHEYKNLSLSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYV
GVNIKGLHLLNMETKALLISLKYCCFTWQLGDAGTCFQIHSMENKMSFIVHTKQAGLVVK
LLMKLNGQLMPSERNS
Download sequence
Identical sequences B2RUA8 Q6S5J6
NP_109600.2.92730 XP_006503680.1.92730 XP_006503681.1.92730 10090.ENSMUSP00000078985 ENSMUSP00000078985 ENSMUSP00000078985 ENSMUSP00000132375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]