SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000079991 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000079991
Domain Number 1 Region: 312-478,869-1045
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.45e-124
Family Mammalian PLC 0.00000573
Further Details:      
 
Domain Number 2 Region: 621-736
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-31
Family SH2 domain 0.0000192
Further Details:      
 
Domain Number 3 Region: 515-636
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-26
Family SH2 domain 0.00046
Further Details:      
 
Domain Number 4 Region: 1062-1183
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.3e-24
Family PLC-like (P variant) 0.003
Further Details:      
 
Domain Number 5 Region: 15-130
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-18
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 
Domain Number 6 Region: 766-831
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-18
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 7 Region: 160-309
Classification Level Classification E-value
Superfamily EF-hand 0.000000295
Family Calbindin D9K 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000079991   Gene: ENSMUSG00000034330   Transcript: ENSMUST00000081232
Sequence length 1265
Comment pep:known chromosome:NCBIM37:8:120022191:120159040:1 gene:ENSMUSG00000034330 transcript:ENSMUST00000081232
Sequence
MTTMVNVDTLPEYEKSQIKRALELGTVMTVFNARKSTPERRTVQMIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRHKAECCFTILYGTQFVLSTLSLATDSKEDAV
KWLSGLKILHQEAMSASTPTMIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSGI
KFLKDKLVEIGAQKDELSFEQFHLFYKKLMFDQQKSILDEFKKDSSVFILGNTDRPDASA
VYLQDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRAGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIRDHAFVTSSFPVILSIEEHCSVEQQRHMAKV
FKEVLGDMLLTKPTEASADQLPSPSQLREKIIIKHKKLGPKGDVDVNVEDKKDEHKPQGE
LYMWDSIDQKWTRHYCAIADAKLSFGDDIEQAVEEEPVQDTPPTELHFGEKWFHKKVESR
TSAEKLLQEYCAETGAKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMENGVMKYY
LTDNLTFNSIYALIQHYREAHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDML
MRIPRDGAFLIRKREGTNSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELTFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISAGDAEEMEKQII
EDNPLGSLCKGILDLNTYNVVKAPQGKNQKAFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKMDTKENNMKYWERNQSIAIELSDLVVYCKPTSKTKDHLENPDFREIRSFVE
TKADSIVRQKPVDLLRYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQMNHALFSLNGRTGYVLQPESMRSEKYDPMPLESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDSNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRGANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SRFYS
Download sequence
Identical sequences Q8CIH5
ENSMUSP00000079991 ENSMUSP00000079991 NP_758489.1.92730 10090.ENSMUSP00000079991 ENSMUSP00000079991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]