SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000080543 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000080543
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.44e-32
Family Ubiquitin-related 0.0000349
Further Details:      
 
Domain Number 2 Region: 74-121
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.00000000000000348
Family Ribosomal protein L40e 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000080543   Gene: ENSMUSG00000062742   Transcript: ENSMUST00000081864
Sequence length 122
Comment pep:known chromosome:NCBIM37:18:35696237:35696605:1 gene:ENSMUSG00000062742 transcript:ENSMUST00000081864
Sequence
MQIFMKTLTGKTITLEVKPSDTIENVKAKIQDKEGIPPDQQRLIFTGKQLEDGRTLSDYN
IQKESTLHLVLHLPSLRQLAQKYNCDKMICRKCYARLHPHAVNCCKKKCGHTNNLRPKKK
VK
Download sequence
Identical sequences D3YYZ2
ENSMUSP00000080543 ENSMUSP00000080543 10090.ENSMUSP00000080543 ENSMUSP00000080543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]